KEGG   Felis catus (domestic cat): 101084297
Entry
101084297         CDS       T02385                                 

Gene name
ATF4
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-4
  KO
K04374  cyclic AMP-dependent transcription factor ATF-4
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04137  Mitophagy - animal
fca04141  Protein processing in endoplasmic reticulum
fca04151  PI3K-Akt signaling pathway
fca04210  Apoptosis
fca04211  Longevity regulating pathway
fca04261  Adrenergic signaling in cardiomyocytes
fca04668  TNF signaling pathway
fca04720  Long-term potentiation
fca04722  Neurotrophin signaling pathway
fca04725  Cholinergic synapse
fca04728  Dopaminergic synapse
fca04911  Insulin secretion
fca04912  GnRH signaling pathway
fca04915  Estrogen signaling pathway
fca04918  Thyroid hormone synthesis
fca04922  Glucagon signaling pathway
fca04925  Aldosterone synthesis and secretion
fca04926  Relaxin signaling pathway
fca04927  Cortisol synthesis and secretion
fca04928  Parathyroid hormone synthesis, secretion and action
fca04932  Non-alcoholic fatty liver disease
fca04934  Cushing syndrome
fca04935  Growth hormone synthesis, secretion and action
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05014  Amyotrophic lateral sclerosis
fca05020  Prion disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05030  Cocaine addiction
fca05031  Amphetamine addiction
fca05034  Alcoholism
fca05161  Hepatitis B
fca05163  Human cytomegalovirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05203  Viral carcinogenesis
fca05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101084297 (ATF4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101084297 (ATF4)
   04668 TNF signaling pathway
    101084297 (ATF4)
   04022 cGMP-PKG signaling pathway
    101084297 (ATF4)
   04151 PI3K-Akt signaling pathway
    101084297 (ATF4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    101084297 (ATF4)
  09143 Cell growth and death
   04210 Apoptosis
    101084297 (ATF4)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101084297 (ATF4)
   04922 Glucagon signaling pathway
    101084297 (ATF4)
   04912 GnRH signaling pathway
    101084297 (ATF4)
   04915 Estrogen signaling pathway
    101084297 (ATF4)
   04926 Relaxin signaling pathway
    101084297 (ATF4)
   04935 Growth hormone synthesis, secretion and action
    101084297 (ATF4)
   04918 Thyroid hormone synthesis
    101084297 (ATF4)
   04928 Parathyroid hormone synthesis, secretion and action
    101084297 (ATF4)
   04925 Aldosterone synthesis and secretion
    101084297 (ATF4)
   04927 Cortisol synthesis and secretion
    101084297 (ATF4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101084297 (ATF4)
  09156 Nervous system
   04725 Cholinergic synapse
    101084297 (ATF4)
   04728 Dopaminergic synapse
    101084297 (ATF4)
   04720 Long-term potentiation
    101084297 (ATF4)
   04722 Neurotrophin signaling pathway
    101084297 (ATF4)
  09149 Aging
   04211 Longevity regulating pathway
    101084297 (ATF4)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101084297 (ATF4)
  09162 Cancer: specific types
   05215 Prostate cancer
    101084297 (ATF4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101084297 (ATF4)
   05012 Parkinson disease
    101084297 (ATF4)
   05014 Amyotrophic lateral sclerosis
    101084297 (ATF4)
   05020 Prion disease
    101084297 (ATF4)
   05022 Pathways of neurodegeneration - multiple diseases
    101084297 (ATF4)
  09165 Substance dependence
   05030 Cocaine addiction
    101084297 (ATF4)
   05031 Amphetamine addiction
    101084297 (ATF4)
   05034 Alcoholism
    101084297 (ATF4)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101084297 (ATF4)
   04934 Cushing syndrome
    101084297 (ATF4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101084297 (ATF4)
   05161 Hepatitis B
    101084297 (ATF4)
   05163 Human cytomegalovirus infection
    101084297 (ATF4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    101084297 (ATF4)
Transcription factors [BR:fca03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    101084297 (ATF4)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 DUF4407 DUF3450 MCU AAA_13 Nop53 bZIP_Maf Laminin_II
Other DBs
NCBI-GeneID: 101084297
NCBI-ProteinID: XP_003989324
Ensembl: ENSFCAG00000009288
UniProt: M3WB57
Position
B4
AA seq 352 aa
MAEMMSFLSSEVLGGDLMSPFDQSGLGAEVSLGLLDDYLEVAKHFKPHGFSSDKAKAGSS
EWLAVDGLVSASDNGKEDAFSGTDWMVEKMDLKEFDSGSLFNIDDLETMPDELLATLDDT
CDLFDPLVQETNKEPPQTMNPIGHLPESLPKTDQVAPFTFLQPLSLSPGALSSTPDHSFS
LELRSEVDISEGDRKPDSTAYILMIPQCIKEEDAPSDNDSGICMSPESYLGSPQHSPSTS
RGSPSKSQLSPCSLCGSAHPKPYDPPGEKTAAKVKVEKLDKKLKKMEQNKTAATRYRQKK
RAEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLIEEVRKAREKKRVP
NT seq 1059 nt   +upstreamnt  +downstreamnt
atggccgagatgatgagcttcctgagcagcgaggtgttggggggggacttgatgtccccc
ttcgaccagtcgggtttgggggctgaagtaagcctaggtctcttagacgattacctggag
gtggccaagcacttcaaacctcatgggttctccagcgacaaggctaaggcgggctcctcc
gaatggctggctgtggatgggttggtcagtgcctcagacaacggcaaggaggatgccttc
tccgggacagattggatggtggagaaaatggatctgaaggagtttgattctggttctctg
ttcaatatagatgacctggaaaccatgccagatgagcttttggccactttggatgacacg
tgtgatctctttgaccccctagtccaggagacgaataaggagcccccccagaccatgaac
ccaattggccatctcccagaaagtttacccaaaacagaccaggttgccccttttaccttc
ctgcaacctctttctctctccccaggggccctgtcctccactccagatcattcctttagt
ttagagctacgcagtgaggtggatatctctgaaggagatagaaagccagactctactgct
tacattctcatgatccctcagtgcataaaggaggaggatgccccctcagataatgatagt
ggcatctgtatgagtcctgagtcctacctggggtccccccagcatagcccctcgacttcg
aggggctctccaagtaagagccagctgtctccatgttccctctgtggttctgcccacccc
aaaccctatgatcctcctggagagaaaacggcagcaaaagtaaaggtggagaagttggat
aagaagctgaaaaaaatggagcagaacaagaccgcagccactaggtaccgccagaagaag
agggcggagcaagaggcccttactggcgagtgtaaagagctagaaaagaagaacgaggct
ctgaaagagagggcagactctttggccaaggagatccagtatctgaaagatttgatagaa
gaggtccgaaaggccagggagaagaaaagggtcccctag

KEGG   Felis catus (domestic cat): 101084784
Entry
101084784         CDS       T02385                                 

Gene name
CREB5
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 5 isoform X7
  KO
K09047  cyclic AMP-responsive element-binding protein 5
Organism
fca  Felis catus (domestic cat)
Pathway
fca04022  cGMP-PKG signaling pathway
fca04024  cAMP signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04152  AMPK signaling pathway
fca04211  Longevity regulating pathway
fca04261  Adrenergic signaling in cardiomyocytes
fca04668  TNF signaling pathway
fca04714  Thermogenesis
fca04725  Cholinergic synapse
fca04728  Dopaminergic synapse
fca04911  Insulin secretion
fca04915  Estrogen signaling pathway
fca04918  Thyroid hormone synthesis
fca04922  Glucagon signaling pathway
fca04925  Aldosterone synthesis and secretion
fca04926  Relaxin signaling pathway
fca04927  Cortisol synthesis and secretion
fca04928  Parathyroid hormone synthesis, secretion and action
fca04931  Insulin resistance
fca04934  Cushing syndrome
fca04935  Growth hormone synthesis, secretion and action
fca04962  Vasopressin-regulated water reabsorption
fca05016  Huntington disease
fca05020  Prion disease
fca05030  Cocaine addiction
fca05031  Amphetamine addiction
fca05034  Alcoholism
fca05161  Hepatitis B
fca05163  Human cytomegalovirus infection
fca05165  Human papillomavirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05203  Viral carcinogenesis
fca05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    101084784 (CREB5)
   04024 cAMP signaling pathway
    101084784 (CREB5)
   04022 cGMP-PKG signaling pathway
    101084784 (CREB5)
   04151 PI3K-Akt signaling pathway
    101084784 (CREB5)
   04152 AMPK signaling pathway
    101084784 (CREB5)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101084784 (CREB5)
   04922 Glucagon signaling pathway
    101084784 (CREB5)
   04915 Estrogen signaling pathway
    101084784 (CREB5)
   04926 Relaxin signaling pathway
    101084784 (CREB5)
   04935 Growth hormone synthesis, secretion and action
    101084784 (CREB5)
   04918 Thyroid hormone synthesis
    101084784 (CREB5)
   04928 Parathyroid hormone synthesis, secretion and action
    101084784 (CREB5)
   04925 Aldosterone synthesis and secretion
    101084784 (CREB5)
   04927 Cortisol synthesis and secretion
    101084784 (CREB5)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101084784 (CREB5)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    101084784 (CREB5)
  09156 Nervous system
   04725 Cholinergic synapse
    101084784 (CREB5)
   04728 Dopaminergic synapse
    101084784 (CREB5)
  09149 Aging
   04211 Longevity regulating pathway
    101084784 (CREB5)
  09159 Environmental adaptation
   04714 Thermogenesis
    101084784 (CREB5)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101084784 (CREB5)
  09162 Cancer: specific types
   05215 Prostate cancer
    101084784 (CREB5)
  09164 Neurodegenerative disease
   05016 Huntington disease
    101084784 (CREB5)
   05020 Prion disease
    101084784 (CREB5)
  09165 Substance dependence
   05030 Cocaine addiction
    101084784 (CREB5)
   05031 Amphetamine addiction
    101084784 (CREB5)
   05034 Alcoholism
    101084784 (CREB5)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101084784 (CREB5)
   04934 Cushing syndrome
    101084784 (CREB5)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101084784 (CREB5)
   05161 Hepatitis B
    101084784 (CREB5)
   05163 Human cytomegalovirus infection
    101084784 (CREB5)
   05165 Human papillomavirus infection
    101084784 (CREB5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    101084784 (CREB5)
Transcription factors [BR:fca03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    101084784 (CREB5)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ZapB TolA_bind_tri NDUFB11 Cnn_1N DivIC
Other DBs
NCBI-GeneID: 101084784
NCBI-ProteinID: XP_003982946
Ensembl: ENSFCAG00000015784
UniProt: A0A2I2ULB1
Position
A2
AA seq 367 aa
MFCTSGGNSASVMSMRPVPGSLSSLLHLHNRQRQPMPASMPGTLPNPTMPGSSAVSMPME
RQMSVNSNLLGMQGPNLSNPCASPQVQPMHSEAKMRLKAALTHHPAAMSNGNMNTMGHMM
EMMGSRQDQTPHHHMHSHPHQHQTLPAHHPYPHQHQHPAHHPHPQPHHQQNHPHHHSHLH
AHPAHHQTSPHPPLHSGNQAQVSPATQQMQPTQTIQPPQPTGGRRRRVVDEDPDERRRKF
LERNRAAATRCRQKRKVWVMSLEKKAEELTQTNMQLQNEVSMLKNEVAQLKQLLLTHKDC
PITAMQKESQGYLSPESSPPASPVPACSQHQVIQHNTVTTSSAVSEVVGSSTLSQLTTHR
TDLNPIL
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgttctgcacctcaggagggaattcagcctcagtgatgtccatgaggcctgtcccaggc
tctctatcttctctgctacatctccacaacagacagagacagcccatgccagcctccatg
cctgggaccctgcccaacccaacaatgccgggatcttctgccgtctccatgccaatggag
agacaaatgtcagtgaactccaacctcctgggaatgcaaggtccaaatctcagcaacccg
tgtgcttctccccaagtccagccaatgcattcagaagccaaaatgaggttgaaggccgcg
ttgactcaccaccccgctgccatgtcaaatgggaatatgaacaccatgggacacatgatg
gaaatgatgggctcccggcaggaccagacgccacaccatcacatgcactcgcacccacat
cagcaccagacgctgccagcccatcacccctacccgcaccagcaccagcacccagcccac
catcctcaccctcaaccccatcaccagcagaaccacccacatcatcactcccaccttcac
gcacaccctgcacatcaccagacctcgccacacccacccctgcactccggcaaccaagca
caggtttcaccagcgacacaacagatgcagccgacccagacaatacagccgccccagccc
acaggggggcgccggcgaagggtggtggatgaggatcccgacgagaggcggaggaaattt
ctggaacggaaccgggccgctgccacccgctgcagacagaagaggaaggtctgggtgatg
tcactggaaaagaaagcagaagaactcacccagacaaacatgcagcttcagaatgaagtg
tccatgttgaaaaatgaggtggcccagctgaaacagttgttgttaacacataaagactgt
ccaataacagccatgcagaaagaatcacaaggatatctaagtccggagagcagtcctccc
gccagccccgtcccagcttgctctcagcaccaggtcatccaacataataccgtcaccact
tcctctgcagtgagcgaggtggtgggaagctccaccctcagtcagctcaccactcacaga
acagacctgaatcccatcctttaa

KEGG   Felis catus (domestic cat): 101087097
Entry
101087097         CDS       T02385                                 

Gene name
CREB3L1
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 1
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
fca  Felis catus (domestic cat)
Pathway
fca04022  cGMP-PKG signaling pathway
fca04024  cAMP signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04152  AMPK signaling pathway
fca04211  Longevity regulating pathway
fca04261  Adrenergic signaling in cardiomyocytes
fca04668  TNF signaling pathway
fca04714  Thermogenesis
fca04725  Cholinergic synapse
fca04728  Dopaminergic synapse
fca04911  Insulin secretion
fca04915  Estrogen signaling pathway
fca04916  Melanogenesis
fca04918  Thyroid hormone synthesis
fca04922  Glucagon signaling pathway
fca04925  Aldosterone synthesis and secretion
fca04926  Relaxin signaling pathway
fca04927  Cortisol synthesis and secretion
fca04928  Parathyroid hormone synthesis, secretion and action
fca04931  Insulin resistance
fca04934  Cushing syndrome
fca04935  Growth hormone synthesis, secretion and action
fca04962  Vasopressin-regulated water reabsorption
fca05016  Huntington disease
fca05020  Prion disease
fca05030  Cocaine addiction
fca05031  Amphetamine addiction
fca05034  Alcoholism
fca05161  Hepatitis B
fca05163  Human cytomegalovirus infection
fca05165  Human papillomavirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05203  Viral carcinogenesis
fca05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    101087097 (CREB3L1)
   04024 cAMP signaling pathway
    101087097 (CREB3L1)
   04022 cGMP-PKG signaling pathway
    101087097 (CREB3L1)
   04151 PI3K-Akt signaling pathway
    101087097 (CREB3L1)
   04152 AMPK signaling pathway
    101087097 (CREB3L1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101087097 (CREB3L1)
   04922 Glucagon signaling pathway
    101087097 (CREB3L1)
   04915 Estrogen signaling pathway
    101087097 (CREB3L1)
   04926 Relaxin signaling pathway
    101087097 (CREB3L1)
   04935 Growth hormone synthesis, secretion and action
    101087097 (CREB3L1)
   04918 Thyroid hormone synthesis
    101087097 (CREB3L1)
   04928 Parathyroid hormone synthesis, secretion and action
    101087097 (CREB3L1)
   04916 Melanogenesis
    101087097 (CREB3L1)
   04925 Aldosterone synthesis and secretion
    101087097 (CREB3L1)
   04927 Cortisol synthesis and secretion
    101087097 (CREB3L1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101087097 (CREB3L1)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    101087097 (CREB3L1)
  09156 Nervous system
   04725 Cholinergic synapse
    101087097 (CREB3L1)
   04728 Dopaminergic synapse
    101087097 (CREB3L1)
  09149 Aging
   04211 Longevity regulating pathway
    101087097 (CREB3L1)
  09159 Environmental adaptation
   04714 Thermogenesis
    101087097 (CREB3L1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101087097 (CREB3L1)
  09162 Cancer: specific types
   05215 Prostate cancer
    101087097 (CREB3L1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    101087097 (CREB3L1)
   05020 Prion disease
    101087097 (CREB3L1)
  09165 Substance dependence
   05030 Cocaine addiction
    101087097 (CREB3L1)
   05031 Amphetamine addiction
    101087097 (CREB3L1)
   05034 Alcoholism
    101087097 (CREB3L1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101087097 (CREB3L1)
   04934 Cushing syndrome
    101087097 (CREB3L1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101087097 (CREB3L1)
   05161 Hepatitis B
    101087097 (CREB3L1)
   05163 Human cytomegalovirus infection
    101087097 (CREB3L1)
   05165 Human papillomavirus infection
    101087097 (CREB3L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    101087097 (CREB3L1)
Transcription factors [BR:fca03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    101087097 (CREB3L1)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf LMBR1 ELP6 Jnk-SapK_ap_N Spc29 TPR_MLP1_2 Prominin APG6_N HAUS-augmin3 JMY RNase_Y_N DUF4404 ADIP DUF724
Other DBs
NCBI-GeneID: 101087097
NCBI-ProteinID: XP_003993253
Ensembl: ENSFCAG00000018794
UniProt: M3WP91
Position
D1
AA seq 520 aa
MDAVLEPFPADRLFPGSSFLDLGDLNESDFLNNAHFPEHLDHFAENMEDFSNDLFSSFFD
DPVLDEKSPLLDMELDSPTPGIQAEHSYSLSGDSAPQSPLVPIKMEDTTQDVEQEAWVLG
HKLCSVMVKQEQSPELPVDPLAASSAMAAAAAMATTPLLGLSPLSRLPVPHQAPGEMTQL
PVIKAEPQEVNQFLKVTPEDLVQMPLTPPSSHGSDSDGSQSPRSLPPSSPVRPMARSSTA
ISTSPLLTAPHKLQGTSGPLLLTEEEKRTLIAEGYPIPTKLPLTKAEEKALKRVRRKIKN
KISAQESRRKKKEYVECLEKKVETFTSENNELWKKVETLENANRTLLQQLQKLQTLVTNK
ISRPYKMAATQTGTCLMVAALCFVLVLGSLVPCLPEFSSSSQTVKEDPVAADSVYTASQM
PSRSLLFYDEGAGSWEDGRSALLPVEPPDGWEIKPGGPAEQRPQDHLQLDHLDSTHETTK
YLSEAWPKDVGGNGTSPDFSHPKEWFRERDLGPNTTIKLS
NT seq 1563 nt   +upstreamnt  +downstreamnt
atggacgccgtcttggagcccttcccggccgacaggctgttccccggatccagcttcctg
gacctgggggatctgaacgagtcggatttcctcaacaatgcgcatttccctgagcacctg
gaccacttcgcggagaacatggaggacttctctaatgacctgttcagcagtttctttgac
gaccctgtgctggacgagaagagccctctactggacatggaactggactcccccacacca
ggcatccaggctgagcatagctactccctgagcggtgactcggcacctcagagccccctt
gtgcccatcaagatggaggacaccacccaagacgtggaacaggaagcatgggtgctggga
cacaaactgtgctccgtcatggtgaagcaggagcagagcccggagctgcccgtggaccct
ctggccgcctcctcagccatggctgctgctgctgccatggccaccaccccgctgctgggc
ctcagccccctgtccaggctgcctgtcccccaccaggccccaggagagatgactcagctg
ccagtgatcaaagcggagccccaggaggtgaatcagttcctcaaagtgacaccagaggac
ctggtgcagatgcctctgacgccccccagcagccacggcagcgacagtgacggctcccag
agtccccgctctctgcccccctccagccctgtccggcccatggcccgctcctccacggcc
atctccacctccccccttctcaccgcccctcacaaattacaggggacatcagggccgctg
ctcctgacagaggaggagaaacgcaccctgattgctgagggctaccccatccccacgaag
ctccccctcaccaaagccgaagaaaaggccttaaagagggtccggagaaaaatcaagaat
aagatctcggcccaggagagccgccgcaagaagaaggagtacgtggaatgtctagaaaag
aaggtggagacatttacatcagagaacaatgaactgtggaagaaagtagagaccctggag
aatgccaacaggaccctgctgcagcagctgcagaaactccagactctggtcaccaacaag
atctcaagaccttacaagatggccgccacccagactgggacctgcctcatggtggcggcc
ttgtgcttcgttctggtgctgggctcccttgtgccctgcctccctgagttctcctccagc
tcccagactgtgaaggaagaccccgtggccgctgacagcgtctacacagccagtcagatg
ccctcccggagcctcctgttctacgatgagggggcaggctcgtgggaggatggccgcagt
gccctgctgcctgtggagcccccagatggctgggagatcaagccgggggggccagcagag
cagcggccccaggaccacctgcagcttgaccacctggacagcacccacgagaccaccaag
tacctgagtgaggcctggccaaaagacgtcggtggaaatggcaccagccccgacttctct
catcccaaggagtggttccgtgagagggatctgggccccaataccaccatcaaactctcc
tag

KEGG   Felis catus (domestic cat): 101089838
Entry
101089838         CDS       T02385                                 

Gene name
CREB3L3
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 3 isoform X1
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
fca  Felis catus (domestic cat)
Pathway
fca04022  cGMP-PKG signaling pathway
fca04024  cAMP signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04152  AMPK signaling pathway
fca04211  Longevity regulating pathway
fca04261  Adrenergic signaling in cardiomyocytes
fca04668  TNF signaling pathway
fca04714  Thermogenesis
fca04725  Cholinergic synapse
fca04728  Dopaminergic synapse
fca04911  Insulin secretion
fca04915  Estrogen signaling pathway
fca04916  Melanogenesis
fca04918  Thyroid hormone synthesis
fca04922  Glucagon signaling pathway
fca04925  Aldosterone synthesis and secretion
fca04926  Relaxin signaling pathway
fca04927  Cortisol synthesis and secretion
fca04928  Parathyroid hormone synthesis, secretion and action
fca04931  Insulin resistance
fca04934  Cushing syndrome
fca04935  Growth hormone synthesis, secretion and action
fca04962  Vasopressin-regulated water reabsorption
fca05016  Huntington disease
fca05020  Prion disease
fca05030  Cocaine addiction
fca05031  Amphetamine addiction
fca05034  Alcoholism
fca05161  Hepatitis B
fca05163  Human cytomegalovirus infection
fca05165  Human papillomavirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05203  Viral carcinogenesis
fca05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    101089838 (CREB3L3)
   04024 cAMP signaling pathway
    101089838 (CREB3L3)
   04022 cGMP-PKG signaling pathway
    101089838 (CREB3L3)
   04151 PI3K-Akt signaling pathway
    101089838 (CREB3L3)
   04152 AMPK signaling pathway
    101089838 (CREB3L3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101089838 (CREB3L3)
   04922 Glucagon signaling pathway
    101089838 (CREB3L3)
   04915 Estrogen signaling pathway
    101089838 (CREB3L3)
   04926 Relaxin signaling pathway
    101089838 (CREB3L3)
   04935 Growth hormone synthesis, secretion and action
    101089838 (CREB3L3)
   04918 Thyroid hormone synthesis
    101089838 (CREB3L3)
   04928 Parathyroid hormone synthesis, secretion and action
    101089838 (CREB3L3)
   04916 Melanogenesis
    101089838 (CREB3L3)
   04925 Aldosterone synthesis and secretion
    101089838 (CREB3L3)
   04927 Cortisol synthesis and secretion
    101089838 (CREB3L3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101089838 (CREB3L3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    101089838 (CREB3L3)
  09156 Nervous system
   04725 Cholinergic synapse
    101089838 (CREB3L3)
   04728 Dopaminergic synapse
    101089838 (CREB3L3)
  09149 Aging
   04211 Longevity regulating pathway
    101089838 (CREB3L3)
  09159 Environmental adaptation
   04714 Thermogenesis
    101089838 (CREB3L3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101089838 (CREB3L3)
  09162 Cancer: specific types
   05215 Prostate cancer
    101089838 (CREB3L3)
  09164 Neurodegenerative disease
   05016 Huntington disease
    101089838 (CREB3L3)
   05020 Prion disease
    101089838 (CREB3L3)
  09165 Substance dependence
   05030 Cocaine addiction
    101089838 (CREB3L3)
   05031 Amphetamine addiction
    101089838 (CREB3L3)
   05034 Alcoholism
    101089838 (CREB3L3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101089838 (CREB3L3)
   04934 Cushing syndrome
    101089838 (CREB3L3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101089838 (CREB3L3)
   05161 Hepatitis B
    101089838 (CREB3L3)
   05163 Human cytomegalovirus infection
    101089838 (CREB3L3)
   05165 Human papillomavirus infection
    101089838 (CREB3L3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    101089838 (CREB3L3)
Transcription factors [BR:fca03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    101089838 (CREB3L3)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf pEK499_p136 DUF1664
Other DBs
NCBI-GeneID: 101089838
NCBI-ProteinID: XP_003981746
Ensembl: ENSFCAG00000014139
Position
A2
AA seq 449 aa
MNGDLAAGKMASSTGPMGPIGSLELLDLLFDHQDGILRHVELGEDWGHLEDQQVLPGPDS
DDFLNSILASGDSVPSSPIWSPAASDSGISEDLPSDSQDTPPRSGAATTPAGCPPYHPGA
PCLAGPPGPVAQVLDASVAIDLEMWSQGLRREERAELADLPLSCSLTVKDLLLSGGGGDL
QQHHPGAPHLPRPATQHCQELVLTEDEKKLLAKEGLTLPTQLPLTKYEERALKKIRRKIR
NKQSAQESRKKKKEYIDGLETRMSACTAQNQELQRKVLHLEKQNLSLLEQLKKLQAIVVQ
STGKSAQTGTCIAVLLFSFALIVLPSISPFVANKAESAGDYAPVRVFSRTLHNDAASRVA
PDATPGSEVPGPRPKAGASQEGSPGSPRADWESQGKSALDNLTEELDNSTLIADNSTEKL
NRATLLDWTAPEPALSPGRGGLEAAGEEL
NT seq 1350 nt   +upstreamnt  +downstreamnt
atgaatggggatttagcagctggaaagatggcttcctccaccggtcccatgggccccatt
ggcagcctggagctcctggacctgctgtttgaccatcaggacggcatcctgagacacgta
gagctgggcgaggactggggccacctcgaggaccagcaggtcctgccaggcccagactca
gatgatttcctcaactccatcctggcttctggagactcggtgcccagctccccgatctgg
tctcctgcagccagtgacagtggcatctctgaagacctgccctccgactcccaggacacc
cctccacgcagtggggcagccaccacccccgcgggctgccccccctaccacccgggagcc
ccctgcctcgccgggccccccggacccgtggcccaagtgctggacgcgtctgtggccata
gacttggaaatgtggagccagggcctccgtcgtgaggagcgggctgagctggccgacctg
cctttgagctgcagcctcacggtgaaagacctcctcctctcgggcggcggcggcgacctg
cagcagcatcacccgggggcccctcacctgccccggcctgcgacccagcactgccaggag
ctggtgctgacggaggacgagaagaagcttctggccaaagaaggcctcaccctgcccacc
cagctgcccctcaccaagtatgaagagcgagcgctgaaaaaaatccgccggaaaatccgc
aacaagcagtcggcccaagagagccggaaaaagaagaaggaatatattgatggcctggaa
actcggatgtcagcctgcactgcccagaaccaggagcttcagaggaaggtcttgcatctg
gagaagcagaacctgtccctcttggagcagctgaagaagctccaggccattgtggtccag
tccactggcaagtcggcccagacgggcacctgcatagcggtcctgctgttctcctttgcc
ctcatcgtcctgccctccattagccctttcgtcgccaacaaggccgagagcgccggagac
tacgcgcccgttcgagttttctccaggactttgcacaacgacgctgcgtcccgtgtggcc
cccgacgccacaccaggctccgaggtcccaggaccacggcccaaagccggcgcgtcccag
gaagggtctccaggcagccccagggcagactgggaatctcagggcaagtcggctctggac
aacttgacggaggagttggacaactcgaccctgatcgcagacaactcgacggagaagctg
aaccgggccaccctgctggactggactgcccctgagccagcgctcagccctgggcgcggg
ggattggaggcagcaggggaggagctgtga

KEGG   Felis catus (domestic cat): 101090884
Entry
101090884         CDS       T02385                                 

Gene name
ATF2
Definition
(RefSeq) LOW QUALITY PROTEIN: cyclic AMP-dependent transcription factor ATF-2
  KO
K04450  cyclic AMP-dependent transcription factor ATF-2
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04211  Longevity regulating pathway
fca04261  Adrenergic signaling in cardiomyocytes
fca04668  TNF signaling pathway
fca04714  Thermogenesis
fca04728  Dopaminergic synapse
fca04911  Insulin secretion
fca04915  Estrogen signaling pathway
fca04918  Thyroid hormone synthesis
fca04922  Glucagon signaling pathway
fca04925  Aldosterone synthesis and secretion
fca04926  Relaxin signaling pathway
fca04927  Cortisol synthesis and secretion
fca04928  Parathyroid hormone synthesis, secretion and action
fca04934  Cushing syndrome
fca04935  Growth hormone synthesis, secretion and action
fca05020  Prion disease
fca05030  Cocaine addiction
fca05031  Amphetamine addiction
fca05034  Alcoholism
fca05161  Hepatitis B
fca05163  Human cytomegalovirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101090884 (ATF2)
   04668 TNF signaling pathway
    101090884 (ATF2)
   04022 cGMP-PKG signaling pathway
    101090884 (ATF2)
   04151 PI3K-Akt signaling pathway
    101090884 (ATF2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101090884 (ATF2)
   04922 Glucagon signaling pathway
    101090884 (ATF2)
   04915 Estrogen signaling pathway
    101090884 (ATF2)
   04926 Relaxin signaling pathway
    101090884 (ATF2)
   04935 Growth hormone synthesis, secretion and action
    101090884 (ATF2)
   04918 Thyroid hormone synthesis
    101090884 (ATF2)
   04928 Parathyroid hormone synthesis, secretion and action
    101090884 (ATF2)
   04925 Aldosterone synthesis and secretion
    101090884 (ATF2)
   04927 Cortisol synthesis and secretion
    101090884 (ATF2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101090884 (ATF2)
  09156 Nervous system
   04728 Dopaminergic synapse
    101090884 (ATF2)
  09149 Aging
   04211 Longevity regulating pathway
    101090884 (ATF2)
  09159 Environmental adaptation
   04714 Thermogenesis
    101090884 (ATF2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101090884 (ATF2)
  09164 Neurodegenerative disease
   05020 Prion disease
    101090884 (ATF2)
  09165 Substance dependence
   05030 Cocaine addiction
    101090884 (ATF2)
   05031 Amphetamine addiction
    101090884 (ATF2)
   05034 Alcoholism
    101090884 (ATF2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101090884 (ATF2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101090884 (ATF2)
   05161 Hepatitis B
    101090884 (ATF2)
   05163 Human cytomegalovirus infection
    101090884 (ATF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    101090884 (ATF2)
Transcription factors [BR:fca03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    101090884 (ATF2)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf zf-C2H2 Herpes_UL16
Other DBs
NCBI-GeneID: 101090884
NCBI-ProteinID: XP_023115244
Ensembl: ENSFCAG00000027595
Position
C1
AA seq 505 aa
MKFKLHVNSARQYKDLWNMSDDKPFLCTAPGCGQRFTNEDHLAVHKHKHEMTLKFGPARN
DSVIVADQTPTPTRFLXNCEEVGLFNELASPFENEFKKASEDDIKKMPLDLSPLATPIIR
SKIEEPSVVETTHQDSPLPHPESTTSDEKEVPLAQTAQPTSAIVRPASLQVPNVLLTSSD
SSVIIQQAVPSPTSSTVITQAPSSNRPIVPVPGPFPLLLHLPNGQTMPVAIPASITSSNV
HVPAAVPLVRPVTMVPSVPGIPGPSSPQPVQSEAKMRLKAALTQQHPPVTNGDTVKGHGS
GLVRTQSEESRPQSLQQPATSTTETPASPAHTTPQTQNTSGRRRRAANEDPDEKRRKFLE
RNRAAASRCRQKRKVWVQSLEKKAEDLSSLNGQLQSEVTLLRNEVAQLKQLLLAHKDCPV
TAMQKKSGYHTADKDDSSEDLSVPSSPHPEAIQHSSVSTSNGVSSTSKAEAVATSVLTQM
ADQSTEPALSQIVMAPASQSQPSGS
NT seq 1518 nt   +upstreamnt  +downstreamnt
atgaaattcaagttacatgtgaattctgccaggcaatacaaggacctgtggaatatgagt
gatgacaaaccctttctatgcactgcccctggatgtggccagcgttttaccaacgaggat
catttggctgtccataaacataaacatgagatgacactgaaatttggtccagcacgtaat
gacagtgtcattgtggctgatcagaccccaacaccaacaagattcttgnnaaactgtgaa
gaagtgggtttgtttaatgaattggcaagtccatttgagaatgaattcaagaaagcctca
gaagacgacattaaaaaaatgcctctagatttatcccctcttgcaacacccattataaga
agcaaaattgaggagccctctgttgtagaaacaactcaccaagatagtcctttacctcac
ccagaatctactaccagtgatgaaaaggaggtaccattggcacaaactgcacagcccaca
tcagctatcgttcgtccagcatcattacaggttcccaacgtgctgcttacaagttctgac
tccagtgtaattattcagcaagcagtaccttcaccaacctcaagtactgtgatcacccag
gcaccatcctccaacaggccaatcgttcctgtaccgggcccatttcctcttctgttgcat
cttcctaatggacagaccatgcctgttgctattcccgcatcaattacaagttctaatgtg
catgttccagctgcagtcccgcttgttcggccagtcaccatggtgcctagtgttccagga
attccaggtccttcctcccctcaaccagtacagtcagaagcaaaaatgagattaaaagct
gctttgacccagcaacatcctccagttaccaatggtgatactgtcaaaggtcatggtagt
ggattggttagaactcagtcagaggaatctcgaccacagtccctacaacagccagccaca
tccactacagaaactccggcttctccagctcacacaactccacagactcaaaatacaagc
ggtcgtcgaagaagagcagctaatgaagatcctgatgaaaaaaggaggaaatttctagag
cgaaatagagcagcagcatcaagatgccgacaaaaaaggaaagtctgggttcagtcttta
gagaagaaagcagaagacttgagttcattaaatggtcaactgcagagtgaagtcaccctg
ctgagaaatgaagtggcacagctgaaacagcttcttctggctcataaagattgccctgta
accgccatgcagaagaaatctggctatcatactgctgataaagacgatagttcagaagac
ctgtccgtgccaagcagcccgcaccctgaagctatacagcatagttctgtcagcacatcc
aatggagtcagttcaacctccaaggccgaagctgtggccacctcagtcctcacacagatg
gcggaccagagtacagagcccgcgctgtcgcagattgttatggctcctgcctcccagtca
cagccctcaggaagttga

KEGG   Felis catus (domestic cat): 101091299
Entry
101091299         CDS       T02385                                 

Gene name
CREB1
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 1 isoform X3
Organism
fca  Felis catus (domestic cat)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ASD2
Other DBs
NCBI-GeneID: 101091299
NCBI-ProteinID: XP_019694098
Ensembl: ENSFCAG00000008220
Position
C1
AA seq 111 aa
MSVNLNSERQFEDAASGDVQTYQIRTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRL
MKNREAARECRRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKSD
NT seq 336 nt   +upstreamnt  +downstreamnt
atgtcagtgaatttgaattctgaacgtcagtttgaagatgctgcctctggagatgtacag
acgtaccagattcgcacagcacccactagcaccattgcccccggagttgttatggcatcc
tccccagcacttcctacacagcctgctgaagaagcagcacgaaagagagaggttcgcctc
atgaagaacagggaagcagcacgagagtgtcgtagaaagaagaaagaatatgtgaaatgt
ttagaaaacagagtggcagtgcttgaaaaccaaaataagactctcattgaggagctaaaa
gcacttaaggacctttactgccacaaatcagattaa

KEGG   Felis catus (domestic cat): 101093555
Entry
101093555         CDS       T02385                                 

Gene name
CREB3
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
fca  Felis catus (domestic cat)
Pathway
fca04022  cGMP-PKG signaling pathway
fca04024  cAMP signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04152  AMPK signaling pathway
fca04211  Longevity regulating pathway
fca04261  Adrenergic signaling in cardiomyocytes
fca04668  TNF signaling pathway
fca04714  Thermogenesis
fca04725  Cholinergic synapse
fca04728  Dopaminergic synapse
fca04911  Insulin secretion
fca04915  Estrogen signaling pathway
fca04916  Melanogenesis
fca04918  Thyroid hormone synthesis
fca04922  Glucagon signaling pathway
fca04925  Aldosterone synthesis and secretion
fca04926  Relaxin signaling pathway
fca04927  Cortisol synthesis and secretion
fca04928  Parathyroid hormone synthesis, secretion and action
fca04931  Insulin resistance
fca04934  Cushing syndrome
fca04935  Growth hormone synthesis, secretion and action
fca04962  Vasopressin-regulated water reabsorption
fca05016  Huntington disease
fca05020  Prion disease
fca05030  Cocaine addiction
fca05031  Amphetamine addiction
fca05034  Alcoholism
fca05161  Hepatitis B
fca05163  Human cytomegalovirus infection
fca05165  Human papillomavirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05203  Viral carcinogenesis
fca05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    101093555 (CREB3)
   04024 cAMP signaling pathway
    101093555 (CREB3)
   04022 cGMP-PKG signaling pathway
    101093555 (CREB3)
   04151 PI3K-Akt signaling pathway
    101093555 (CREB3)
   04152 AMPK signaling pathway
    101093555 (CREB3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101093555 (CREB3)
   04922 Glucagon signaling pathway
    101093555 (CREB3)
   04915 Estrogen signaling pathway
    101093555 (CREB3)
   04926 Relaxin signaling pathway
    101093555 (CREB3)
   04935 Growth hormone synthesis, secretion and action
    101093555 (CREB3)
   04918 Thyroid hormone synthesis
    101093555 (CREB3)
   04928 Parathyroid hormone synthesis, secretion and action
    101093555 (CREB3)
   04916 Melanogenesis
    101093555 (CREB3)
   04925 Aldosterone synthesis and secretion
    101093555 (CREB3)
   04927 Cortisol synthesis and secretion
    101093555 (CREB3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101093555 (CREB3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    101093555 (CREB3)
  09156 Nervous system
   04725 Cholinergic synapse
    101093555 (CREB3)
   04728 Dopaminergic synapse
    101093555 (CREB3)
  09149 Aging
   04211 Longevity regulating pathway
    101093555 (CREB3)
  09159 Environmental adaptation
   04714 Thermogenesis
    101093555 (CREB3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101093555 (CREB3)
  09162 Cancer: specific types
   05215 Prostate cancer
    101093555 (CREB3)
  09164 Neurodegenerative disease
   05016 Huntington disease
    101093555 (CREB3)
   05020 Prion disease
    101093555 (CREB3)
  09165 Substance dependence
   05030 Cocaine addiction
    101093555 (CREB3)
   05031 Amphetamine addiction
    101093555 (CREB3)
   05034 Alcoholism
    101093555 (CREB3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101093555 (CREB3)
   04934 Cushing syndrome
    101093555 (CREB3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101093555 (CREB3)
   05161 Hepatitis B
    101093555 (CREB3)
   05163 Human cytomegalovirus infection
    101093555 (CREB3)
   05165 Human papillomavirus infection
    101093555 (CREB3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    101093555 (CREB3)
Transcription factors [BR:fca03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    101093555 (CREB3)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 ZapB bZIP_Maf ABC_membrane_3
Other DBs
NCBI-GeneID: 101093555
NCBI-ProteinID: XP_003995658
Ensembl: ENSFCAG00000012750
Position
D4
AA seq 353 aa
MELALDLGDQELLDFLLEESGDLGAEQPLSEALNEWEVEDYLISLLSPPTSLNVFSSSDS
CLVHHDHTYSLPQQHVCIDVDGGKYGKEGAQTTPLHVEEPAEQEIARLILTDEEKRLLEK
EGLTLPGTLPLTKMEEQILTRVRRKIRNKKSAQESRRKKRLYMGGLESRVLKYTAQNLEL
QNKVQLLEEQNSSLLDQLRRLQAMVIQISNKTSSSSTCVLVLLFSFCLLVLPAMYSSDTR
GSLPAEHGVLSRQLRALSSEDPHQLELPAQQSEVPKDSSDQELQALGNSCCLLRQMPQAP
GAEPALTLPLPVPSPKSPCSGPVLPLPANFTREGGWLPTHSPTSVILQGRYSG
NT seq 1062 nt   +upstreamnt  +downstreamnt
atggagctggcattggacttgggtgaccaggagctgctggacttcctgctagaagaaagc
ggagatttgggggcagagcagccgctttccgaggcactgaatgaatgggaggtagaggat
tacctgatctccctgctgagtcccccaacgtcgttgaacgttttcagctcctctgattcc
tgtcttgtccaccatgatcacacctactctctcccacagcaacatgtctgtatagatgta
gatggtgggaagtatggaaaagagggggcccagacgactccactccatgtggaggagccg
gcggaacaggagattgctaggttgatactgacagatgaggagaagaggctgttggagaag
gaggggcttactctgcctgggacacttcctcttacaaagatggaggaacaaattttgaca
cgagtgcggaggaagattagaaacaaaaagtctgctcaagagagccgcaggaagaagcgg
ctgtatatgggaggcttagaaagcagagtcttgaaatatacagcccagaatctggagcta
cagaacaaagtacagctcctggaggaacagaattcgtcccttctggaccagctgaggaga
ctccaggccatggtgattcagatatccaacaaaaccagcagcagcagcacctgtgtcttg
gtcctacttttttccttctgtctcctcgtcctacctgctatgtactcctctgacacaagg
gggagcctgccagctgagcatggagtgttgtcccgccagcttcgtgccctctccagcgag
gaccctcaccagctggagctgcctgcccagcagtcagaggtaccaaaggacagctcagac
caggagctccaggctctcggcaactcttgctgtctgctgagacagatgcctcaggctcct
ggtgccgagcctgccttgacattgccacttcctgtcccctccccaaagtccccctgctca
ggtccagtccttcccctgcccgcaaacttcacaagagaagggggatggctccctactcac
agccccacatctgttatcttacagggcagatattcaggctag

KEGG   Felis catus (domestic cat): 101094849
Entry
101094849         CDS       T02385                                 

Gene name
ATF6B
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta isoform X4
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
fca  Felis catus (domestic cat)
Pathway
fca04022  cGMP-PKG signaling pathway
fca04141  Protein processing in endoplasmic reticulum
fca04151  PI3K-Akt signaling pathway
fca04211  Longevity regulating pathway
fca04261  Adrenergic signaling in cardiomyocytes
fca04668  TNF signaling pathway
fca04728  Dopaminergic synapse
fca04911  Insulin secretion
fca04915  Estrogen signaling pathway
fca04918  Thyroid hormone synthesis
fca04925  Aldosterone synthesis and secretion
fca04926  Relaxin signaling pathway
fca04927  Cortisol synthesis and secretion
fca04928  Parathyroid hormone synthesis, secretion and action
fca04934  Cushing syndrome
fca04935  Growth hormone synthesis, secretion and action
fca05020  Prion disease
fca05030  Cocaine addiction
fca05031  Amphetamine addiction
fca05034  Alcoholism
fca05161  Hepatitis B
fca05163  Human cytomegalovirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101094849 (ATF6B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    101094849 (ATF6B)
   04022 cGMP-PKG signaling pathway
    101094849 (ATF6B)
   04151 PI3K-Akt signaling pathway
    101094849 (ATF6B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101094849 (ATF6B)
   04915 Estrogen signaling pathway
    101094849 (ATF6B)
   04926 Relaxin signaling pathway
    101094849 (ATF6B)
   04935 Growth hormone synthesis, secretion and action
    101094849 (ATF6B)
   04918 Thyroid hormone synthesis
    101094849 (ATF6B)
   04928 Parathyroid hormone synthesis, secretion and action
    101094849 (ATF6B)
   04925 Aldosterone synthesis and secretion
    101094849 (ATF6B)
   04927 Cortisol synthesis and secretion
    101094849 (ATF6B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101094849 (ATF6B)
  09156 Nervous system
   04728 Dopaminergic synapse
    101094849 (ATF6B)
  09149 Aging
   04211 Longevity regulating pathway
    101094849 (ATF6B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101094849 (ATF6B)
  09164 Neurodegenerative disease
   05020 Prion disease
    101094849 (ATF6B)
  09165 Substance dependence
   05030 Cocaine addiction
    101094849 (ATF6B)
   05031 Amphetamine addiction
    101094849 (ATF6B)
   05034 Alcoholism
    101094849 (ATF6B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101094849 (ATF6B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101094849 (ATF6B)
   05161 Hepatitis B
    101094849 (ATF6B)
   05163 Human cytomegalovirus infection
    101094849 (ATF6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    101094849 (ATF6B)
Transcription factors [BR:fca03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    101094849 (ATF6B)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf DUF4407 GIT_CC ZapB YabA Docking
Other DBs
NCBI-GeneID: 101094849
NCBI-ProteinID: XP_003986008
Ensembl: ENSFCAG00000018408
Position
B2
AA seq 712 aa
MAGGREGKMAELMLLSEIADPTRFFTDNLLSPEDWGLRNSTLYTGLDDVAEEQTQLFRCP
EQDVPFGSSSLDVGMDVSPPEPPWDPLPIFPDLQVKSEPSSPCSSSSLSSESSRLSTEPS
SQVPAVGEVLVVKTESLAPPLCLLGDDPTSPFETVQINVGPTSDDPSDVQTKLEPVSPSS
SINSEASLLSAESPNQGFIGEEVLEVKTESPSPQGCLLRDVLGPPLGGVQISMGPSSDGS
LGKALPTRKPPLQPKPVVITTVPMPPRAVPPSTTILLQPLVQPPPVSPVVLIQGAIRVQP
EGPAPPAPRPERKSIVPAPMPGNSCPPEVDAKLLKRQQRMIKNRESACQSRRKKKEYLQG
LEARLQAVLADNQQLRRENAALRRRLEALLAENSELKLGSGNRKVVCIMVFLLFIAFNFG
PVSISDPPPAPISPRMSGEEPRPRRHLLEFSAQEPVHGVEPLQGSSLGPEEPQPSPPGRP
SFRNLTAFPGGSAKELLLRDLDQLFLSSDCRHFNRTESLRLADELSGWVQRHQRGRRKIP
QRAQEKQKSQLWKKSPPVKAVPTQPPGPPERDSAGQLQLYRHPDRSQPEFLDAIDRREDT
FYVVSFRRDHLLLPAISHNKTSRPKMSLVMPAMAPNETLSGRGAPGDYEEMMQIECEVMD
TRVIHIKTSTVPPSLRKQPSSTPGNATGGPLPASAAGQARQASHQPLYLNHP
NT seq 2139 nt   +upstreamnt  +downstreamnt
atggctggggggcgggagggaaagatggcggaactgatgctgctcagcgagattgcggac
ccaacacgttttttcaccgataacttgctgagcccggaggactggggtctgcggaacagc
accttgtatactggcttagatgatgtcgcggaggagcagacgcagctcttccgttgccca
gagcaggatgtcccgtttggcagcagttccctggacgtggggatggatgtcagccctcct
gagccaccctgggaccccctgcctatctttccagatcttcaggtgaagtctgagccgtcc
tccccctgctcctcttcctccctcagctctgaatcatcgcgtctttccacagagccctct
agccaggtccctgctgtaggggaggtgctggttgtgaagacagagtccttggcaccccca
ctctgcctcctaggagatgatccaacatccccatttgaaacggtccagatcaatgtgggt
cccacctctgatgacccctcagatgtccagaccaagctagagcctgtctctccatcttcc
tccatcaactctgaggcttccctgctctcagcagagtcccccaaccagggttttatagga
gaggaggtactggaagtgaagacagagtcaccatcccctcaagggtgtctcctgcgggat
gtcctaggccccccacttggaggtgtccagatcagcatgggcccatcctccgatggctcc
ttaggcaaagccctgcctacccggaagccaccgctgcagcccaaacctgtggtgataacc
actgtcccaatgccacccagagctgtgcctcctagcaccaccatccttttgcagcctctt
gtccaaccacccccagtgtcaccagttgtcctcatccaaggtgctattcgggtccagcct
gaggggccggccccccctgctccaaggcctgagaggaagagcattgttccagctcctatg
cctgggaactcctgcccacctgaagtggatgcaaagctgctgaagcggcagcagcgaatg
atcaagaaccgggagtcggcctgccagtccaggaggaagaagaaggagtatctgcagggg
ctggaggctcggctgcaggctgtgctggccgacaaccagcagctccgcagggagaatgct
gccctccggcggcggctggaggccctgctggccgaaaacagcgagctcaagttagggtct
ggaaacaggaaggtggtctgcatcatggtgttccttcttttcattgccttcaactttgga
cctgtcagcatcagtgaccctcctccagctcccatctctcctcggatgagcggagaggag
cctcgaccccggagacacttgctggagttctcagcgcaagagccggttcatggagttgaa
cccctccagggttcctccctgggccctgaggagccccagcccagccccccaggccggcca
agtttcaggaacctgacagccttcccggggggcagtgccaaggagctgctgctgagagac
ctggaccagctcttcctctcctctgattgccggcacttcaaccgaaccgagtccctgagg
cttgcggacgagctgagcggctgggtccagcgtcaccagagaggccggcggaagatcccc
cagagggcccaggagaaacagaagtctcagctctggaagaagtcgcctccagttaaggca
gttcccacccagccccctgggcccccagaaagggattctgcgggccaactgcagctatat
cgccacccagaccgttcgcagccagagttcctggatgcaattgaccgacgagaagacaca
ttttatgttgtgtccttccgaagggaccacttgctgctccctgccatcagccacaacaag
acctctcggcccaagatgtccctggtgatgcctgccatggcccccaatgagaccctgtca
ggccggggggctccaggagactatgaggagatgatgcagatcgagtgtgaggtcatggac
acccgggtgattcacatcaagacctccacggtgcctccctcgctccgaaaacagccatcc
tcgaccccaggcaatgccacaggtggccccttgccagcttctgcagccggccaggcacgc
caggcctcccaccagcccctctacctcaatcacccctga

KEGG   Felis catus (domestic cat): 101100293
Entry
101100293         CDS       T02385                                 

Gene name
CREB3L2
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 2 isoform X1
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
fca  Felis catus (domestic cat)
Pathway
fca04022  cGMP-PKG signaling pathway
fca04024  cAMP signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04152  AMPK signaling pathway
fca04211  Longevity regulating pathway
fca04261  Adrenergic signaling in cardiomyocytes
fca04668  TNF signaling pathway
fca04714  Thermogenesis
fca04725  Cholinergic synapse
fca04728  Dopaminergic synapse
fca04911  Insulin secretion
fca04915  Estrogen signaling pathway
fca04916  Melanogenesis
fca04918  Thyroid hormone synthesis
fca04922  Glucagon signaling pathway
fca04925  Aldosterone synthesis and secretion
fca04926  Relaxin signaling pathway
fca04927  Cortisol synthesis and secretion
fca04928  Parathyroid hormone synthesis, secretion and action
fca04931  Insulin resistance
fca04934  Cushing syndrome
fca04935  Growth hormone synthesis, secretion and action
fca04962  Vasopressin-regulated water reabsorption
fca05016  Huntington disease
fca05020  Prion disease
fca05030  Cocaine addiction
fca05031  Amphetamine addiction
fca05034  Alcoholism
fca05161  Hepatitis B
fca05163  Human cytomegalovirus infection
fca05165  Human papillomavirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05203  Viral carcinogenesis
fca05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    101100293 (CREB3L2)
   04024 cAMP signaling pathway
    101100293 (CREB3L2)
   04022 cGMP-PKG signaling pathway
    101100293 (CREB3L2)
   04151 PI3K-Akt signaling pathway
    101100293 (CREB3L2)
   04152 AMPK signaling pathway
    101100293 (CREB3L2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101100293 (CREB3L2)
   04922 Glucagon signaling pathway
    101100293 (CREB3L2)
   04915 Estrogen signaling pathway
    101100293 (CREB3L2)
   04926 Relaxin signaling pathway
    101100293 (CREB3L2)
   04935 Growth hormone synthesis, secretion and action
    101100293 (CREB3L2)
   04918 Thyroid hormone synthesis
    101100293 (CREB3L2)
   04928 Parathyroid hormone synthesis, secretion and action
    101100293 (CREB3L2)
   04916 Melanogenesis
    101100293 (CREB3L2)
   04925 Aldosterone synthesis and secretion
    101100293 (CREB3L2)
   04927 Cortisol synthesis and secretion
    101100293 (CREB3L2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101100293 (CREB3L2)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    101100293 (CREB3L2)
  09156 Nervous system
   04725 Cholinergic synapse
    101100293 (CREB3L2)
   04728 Dopaminergic synapse
    101100293 (CREB3L2)
  09149 Aging
   04211 Longevity regulating pathway
    101100293 (CREB3L2)
  09159 Environmental adaptation
   04714 Thermogenesis
    101100293 (CREB3L2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101100293 (CREB3L2)
  09162 Cancer: specific types
   05215 Prostate cancer
    101100293 (CREB3L2)
  09164 Neurodegenerative disease
   05016 Huntington disease
    101100293 (CREB3L2)
   05020 Prion disease
    101100293 (CREB3L2)
  09165 Substance dependence
   05030 Cocaine addiction
    101100293 (CREB3L2)
   05031 Amphetamine addiction
    101100293 (CREB3L2)
   05034 Alcoholism
    101100293 (CREB3L2)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101100293 (CREB3L2)
   04934 Cushing syndrome
    101100293 (CREB3L2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101100293 (CREB3L2)
   05161 Hepatitis B
    101100293 (CREB3L2)
   05163 Human cytomegalovirus infection
    101100293 (CREB3L2)
   05165 Human papillomavirus infection
    101100293 (CREB3L2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    101100293 (CREB3L2)
Transcription factors [BR:fca03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    101100293 (CREB3L2)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf HAUS6_N JMY
Other DBs
NCBI-GeneID: 101100293
NCBI-ProteinID: XP_003983143
Ensembl: ENSFCAG00000000648
UniProt: M3VV60
Position
A2
AA seq 520 aa
MEVLESGEQSVLQWDRKLSELSEPGETEALMYHTHFSELLDEFSQNVLGQLLNDPFLSEK
SVSMEVEPSPTSPAPLIQAEHSYSLCEEPRAQSPFTHVATGDSFNDDEVESEKWYLSTDF
PSTTIKTEPITEEPPPGLVPSVTLTITAISTPFEKEEPLLEPNTGVDSSCQTIIPKIKLE
PHEVDQFLNFSPKEASVEHLHLPPTPPSSHSSDSEGSLSPNPRLHPFGLPQTHSPARAAA
RAPSALSSSPLLTAPHKLQGSGPLVLTEEEKRTLIAEGYPIPTKLPLTKSEEKALKKIRR
KIKNKISAQESRRKKKEYMDSLEKKVESCSTENLELRKKVEVLENTNRTLLQQLQKLQTL
VMGKVSRTCKLAGTQTGTCLMVVVLCFAVAFGSFFQGYGPYPSATKMALPSQHSMQEPYT
ASVVRSRNLLIYEEHSPLEEPSGPASAGELGPWDRGSSLLRASGLDPRPEVDLPHFILSN
ESSLEKSVLLELQQHLVSTKLEGNETLKVVELDRRVNATF
NT seq 1563 nt   +upstreamnt  +downstreamnt
atggaggtgctggagagcggggagcagagcgtcctgcagtgggaccgcaagctgagcgag
ctgtcagagcctggggaaaccgaggctctcatgtaccacacgcacttctcagaacttctc
gatgagttttcccagaacgtcttgggtcagctccttaatgaccctttcctctccgagaag
agtgtgtcgatggaggtggaaccgtccccaacatccccggcgcctctcatccaggctgag
cacagctactccctgtgtgaagagcctcgggcccagtcaccgttcacccacgttgccacc
ggtgacagcttcaatgacgatgaagtggaaagtgagaaatggtatctgtctacagacttt
ccatccacaaccatcaagacagagccgattacagaggagccgcccccgggacttgttccc
tctgtcactctgaccatcacggccatctccaccccttttgaaaaggaggaacccctcctg
gaaccgaatactggggttgattcctcctgccagaccattattcctaagattaagctggag
cctcatgaagtggatcagttcctcaacttctctcctaaagaagcctccgtggaacacctg
cacttacctcccacgccccccagcagccacagcagtgactcggagggcagcctgagcccc
aacccccgcctgcaccccttcggcctgccccagacccacagccccgccagagccgcggcc
cgggccccctccgccctgtccagctctcctctcctcacagcgcctcacaaacttcaagga
tcaggcccactcgtcctgacagaagaggagaagaggaccctgatcgccgagggctatccc
atccccaccaaattgcctctaacaaaatcagaggagaaggctctgaagaagatccggagg
aaaatcaagaacaagatttctgcccaggaaagtaggagaaagaagaaagaatacatggac
agcttggagaaaaaggtggagtcttgctccactgagaacttggagcttcggaagaaggtg
gaggttctggagaacaccaacagaactctcctgcagcaactacagaagcttcagacgttg
gtgatgggcaaggtttcgcgcacctgcaagttggcgggcacgcagaccggcacgtgcctc
atggtggttgtgctctgctttgctgttgcatttgggagcttctttcagggctacggaccc
tatccgtctgccaccaagatggctctgcccagccagcactccatgcaggagccctataca
gcctctgtcgtgagatccaggaacctgctcatctatgaggaacattctcccctggaggag
ccgtccggcccagcctcagctggggaacttgggccttgggacagaggctcctccctgctc
agggcatcagggttggatcccaggcctgaagtggatcttccccatttcattctctcaaat
gagagcagcctggagaaatccgtgctattggagttacagcagcacttggtcagcaccaaa
ctggaggggaacgagacactaaaagttgtagaactcgacagaagagtgaacgccaccttc
tga

KEGG   Felis catus (domestic cat): 101100442
Entry
101100442         CDS       T02385                                 

Gene name
CREB3L4
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 4 isoform X2
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
fca  Felis catus (domestic cat)
Pathway
fca04022  cGMP-PKG signaling pathway
fca04024  cAMP signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04152  AMPK signaling pathway
fca04211  Longevity regulating pathway
fca04261  Adrenergic signaling in cardiomyocytes
fca04668  TNF signaling pathway
fca04714  Thermogenesis
fca04725  Cholinergic synapse
fca04728  Dopaminergic synapse
fca04911  Insulin secretion
fca04915  Estrogen signaling pathway
fca04916  Melanogenesis
fca04918  Thyroid hormone synthesis
fca04922  Glucagon signaling pathway
fca04925  Aldosterone synthesis and secretion
fca04926  Relaxin signaling pathway
fca04927  Cortisol synthesis and secretion
fca04928  Parathyroid hormone synthesis, secretion and action
fca04931  Insulin resistance
fca04934  Cushing syndrome
fca04935  Growth hormone synthesis, secretion and action
fca04962  Vasopressin-regulated water reabsorption
fca05016  Huntington disease
fca05020  Prion disease
fca05030  Cocaine addiction
fca05031  Amphetamine addiction
fca05034  Alcoholism
fca05161  Hepatitis B
fca05163  Human cytomegalovirus infection
fca05165  Human papillomavirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05203  Viral carcinogenesis
fca05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    101100442 (CREB3L4)
   04024 cAMP signaling pathway
    101100442 (CREB3L4)
   04022 cGMP-PKG signaling pathway
    101100442 (CREB3L4)
   04151 PI3K-Akt signaling pathway
    101100442 (CREB3L4)
   04152 AMPK signaling pathway
    101100442 (CREB3L4)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101100442 (CREB3L4)
   04922 Glucagon signaling pathway
    101100442 (CREB3L4)
   04915 Estrogen signaling pathway
    101100442 (CREB3L4)
   04926 Relaxin signaling pathway
    101100442 (CREB3L4)
   04935 Growth hormone synthesis, secretion and action
    101100442 (CREB3L4)
   04918 Thyroid hormone synthesis
    101100442 (CREB3L4)
   04928 Parathyroid hormone synthesis, secretion and action
    101100442 (CREB3L4)
   04916 Melanogenesis
    101100442 (CREB3L4)
   04925 Aldosterone synthesis and secretion
    101100442 (CREB3L4)
   04927 Cortisol synthesis and secretion
    101100442 (CREB3L4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101100442 (CREB3L4)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    101100442 (CREB3L4)
  09156 Nervous system
   04725 Cholinergic synapse
    101100442 (CREB3L4)
   04728 Dopaminergic synapse
    101100442 (CREB3L4)
  09149 Aging
   04211 Longevity regulating pathway
    101100442 (CREB3L4)
  09159 Environmental adaptation
   04714 Thermogenesis
    101100442 (CREB3L4)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101100442 (CREB3L4)
  09162 Cancer: specific types
   05215 Prostate cancer
    101100442 (CREB3L4)
  09164 Neurodegenerative disease
   05016 Huntington disease
    101100442 (CREB3L4)
   05020 Prion disease
    101100442 (CREB3L4)
  09165 Substance dependence
   05030 Cocaine addiction
    101100442 (CREB3L4)
   05031 Amphetamine addiction
    101100442 (CREB3L4)
   05034 Alcoholism
    101100442 (CREB3L4)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101100442 (CREB3L4)
   04934 Cushing syndrome
    101100442 (CREB3L4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101100442 (CREB3L4)
   05161 Hepatitis B
    101100442 (CREB3L4)
   05163 Human cytomegalovirus infection
    101100442 (CREB3L4)
   05165 Human papillomavirus infection
    101100442 (CREB3L4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    101100442 (CREB3L4)
Transcription factors [BR:fca03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    101100442 (CREB3L4)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf HAUS-augmin3 DUF4200 HAUS5 ZapB
Other DBs
NCBI-GeneID: 101100442
NCBI-ProteinID: XP_003999812
Ensembl: ENSFCAG00000012586
Position
F1
AA seq 395 aa
MDFRTPDLLDAWLESPEDVFSTGTFPEPGLHGPPPEAPGTKLQEQGLRGWEPSGGRGCGL
RDSEPEDFLKLFIDPNEVYCSGASASSDSGHPSADPGRPDRPPAPQAPSPPALYEVVYEA
GALERTQGEAGPAVGFISLQPGQRSPQLTVPDACVVCELPCDAHDTLPGAGTVNPVPPAT
LLPCQTLFLTEEEKRLLGQEGVSLPAHLPLTKAEERVLKKVRRKIRNKQSAQDSRQRKKE
YIDGLESRAAACSAQNQELQKKVQELERCNVSLVAQLRQLQLLAARTSDKAAQTSTCVVI
LLFSLALIILPSVSPFQGLREAGPEDYQPHGVVSRNILSHKDMTEGLETTVVESRPGGPL
KAKGENGSTRTLLEKMGGKTGSNGHAGAVLHAEEM
NT seq 1188 nt   +upstreamnt  +downstreamnt
atggatttccgaacccccgacctgctggatgcgtggctggagtccccagaagatgttttc
tcaacagggaccttcccggagccgggactgcacggcccacctccggaggccccggggacg
aagctccaagaacaggggctgcgaggctgggagcccagtgggggccgtggctgtggcctt
cgagacagtgagcctgaagacttcctgaaacttttcattgaccccaacgaagtgtactgc
tcaggagcctctgctagcagcgacagtggccatccatctgcggaccctggccgtccagac
aggcctcccgcccctcaagcacccagtccccctgctctctatgaggtggtctatgaggca
ggggccctggagaggacgcagggggaagctgggccagctgtagggttcatctctctccag
ccaggtcagcggagcccacaactgacggtgcctgatgcctgcgtggtctgcgagctgccc
tgtgatgctcacgacaccctgcccggagcaggcactgtaaacccagtgcctcctgcgacc
ctgctgccctgtcagaccttgttcctgacagaagaggagaagcgtctgctggggcaggaa
ggggtttccctgcccgcacacctgcccctcaccaaggcagaggagagggtcctcaagaag
gtcaggaggaagatccggaacaagcagtcagctcaggacagtcggcagcggaagaaagag
tacatcgatgggctagagagcagggccgctgcctgctctgcacagaaccaggaactgcag
aaaaaagtccaggagctggagaggtgcaacgtctccctggtagctcagctccgccagctg
cagctgctggctgcccggacctccgacaaagctgcccagaccagcacttgtgtcgtgatc
cttcttttttccctggctctaatcatcctgcccagtgtcagcccctttcagggtctccgg
gaagctgggcctgaggattaccagcctcatggagtggtttccagaaatatcctaagtcac
aaggacatgacagaaggtttggagaccacagtagtagagtccagaccgggggggccactt
aaggccaagggtgaaaatggctcaacaaggacactgcttgagaagatgggagggaagaca
ggctccaatgggcacgcaggagctgtgctgcacgcagaagagatgtga

DBGET integrated database retrieval system