KEGG   Felis catus (domestic cat): 101084319Help
Entry
101084319         CDS       T02385                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: glyceraldehyde-3-phosphate dehydrogenase-like
  KO
K00134  glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00010  Glycolysis / Gluconeogenesis
fca01100  Metabolic pathways
fca01200  Carbon metabolism
fca01230  Biosynthesis of amino acids
fca04066  HIF-1 signaling pathway
fca05010  Alzheimer disease
Module
fca_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
fca_M00002  Glycolysis, core module involving three-carbon compounds
fca_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101084319
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    101084319
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101084319
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101084319
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101084319
Enzymes [BR:fca01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.12  glyceraldehyde-3-phosphate dehydrogenase (phosphorylating)
     101084319
Membrane trafficking [BR:fca04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    101084319
Exosome [BR:fca04147]
 Exosomal proteins
  Proteins found in most exosomes
   101084319
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gp_dh_C Gp_dh_N
Motif
Other DBs
NCBI-GeneID: 101084319
NCBI-ProteinID: XP_011285707
Position
D2
AA seq 362 aa AA seqDB search
MVKVRVNRFGCIGHLITRDAFNSGKVDIVAINDPFIDLTYMVYMFQCDPTHSKLNGTVKV
ENGKLVINGKPISIFQKKDHTNIKWXDAGAEYVVESTRVFTTMEEAGAHLKGXIISTHSS
GTPMFAMGMNYEKYYNSLKIVGNISCNTNCLAPLAKVIHDNFGIVEGPMTTVYAITATQE
TMDDLSGKLCHHGQGATQNILPTSSGAAKAVGKVIPEINRKPTGMAFCVPIPNVSIVGMI
CSLKKTDKYNDIKKVVKQALEGPLKCTLGNTEDHFVSCDFNIDTHSYTFDAGAGFALNDH
FVKQISYYDNEFGYSNWVVDLMVHMVSKEYESPGPPARGSERGRDSASAAGESLPQLTPP
TY
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaagttagagtaaacagatttggctgtattgggcacctaattaccagggatgct
tttaactctggaaaagtggatattgttgccatcaatgaccctttcattgacctcacctac
atggtctacatgttccagtgtgatcctacccacagcaaattaaatggtacagtcaaggtt
gagaatgggaaacttgtcatcaatggaaagcccatctccatcttccagaagaaagatcac
accaacatcaaatggngtgatgctggtgctgagtatgttgtggagtccactcgggtcttc
accaccatggaggaggctggggctcacttgaagggtnntatcatctccactcattcttct
ggtacccccatgtttgcgatgggcatgaactatgagaagtattacaactctctcaagatt
gttggcaatatctcttgcaacaccaactgcttggcccctctggccaaggtcatccatgac
aactttggcatcgtggagggacccatgaccacggtctatgccatcactgccacccaggag
accatggacgacctctctgggaagctgtgtcaccacggccaaggagctacccagaacatt
ctccctacttcttctggtgctgccaaggctgtaggcaaggtcatccctgagataaatagg
aagcccactggcatggccttctgtgtcccgattcccaatgtgtcaattgtaggtatgatc
tgcagcctaaagaaaactgacaagtacaatgacatcaagaaggtggtgaaacaggcatta
gagggccccctcaagtgcaccctgggtaacactgaggaccactttgtctcctgtgacttt
aacattgatacccactcttacacttttgatgctggagcaggctttgctctcaatgaccac
tttgtcaagcaaatttcctattatgacaatgaatttggctacagcaactgggtggtggac
cttatggtccacatggtctccaaggagtatgagtcccctggaccaccagcccgagggagc
gaaagaggaagagacagtgcctcagctgctggagaatctttgccccaactcaccccccca
acatactga

KEGG   Felis catus (domestic cat): 101101594Help
Entry
101101594         CDS       T02385                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: glyceraldehyde-3-phosphate dehydrogenase-like
  KO
K00134  glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00010  Glycolysis / Gluconeogenesis
fca01100  Metabolic pathways
fca01200  Carbon metabolism
fca01230  Biosynthesis of amino acids
fca04066  HIF-1 signaling pathway
fca05010  Alzheimer disease
Module
fca_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
fca_M00002  Glycolysis, core module involving three-carbon compounds
fca_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101101594
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    101101594
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101101594
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101101594
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101101594
Enzymes [BR:fca01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.12  glyceraldehyde-3-phosphate dehydrogenase (phosphorylating)
     101101594
Membrane trafficking [BR:fca04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    101101594
Exosome [BR:fca04147]
 Exosomal proteins
  Proteins found in most exosomes
   101101594
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gp_dh_C Gp_dh_N
Motif
Other DBs
NCBI-GeneID: 101101594
NCBI-ProteinID: XP_011285948
Position
D2
AA seq 371 aa AA seqDB search
MVLRIRKRHIVDTYRAIKNCNALWSSPFTRQTHLLVQGQQCPQDTMVKVRVNGFGHIGCL
VTRAAFNSGKVDIVAISDHFIDLNYMVFMFCYDFTHGKFHSTVKAENGTHVINGKPISIF
QERYSTNSKWADAGAKCAVESTGVSTTMKTGAHLTGGMKRVILSAPSADAPMSVMGVNCE
KYGNSFKIVSNTSCTTNCLAPLAEVIYDNFSIVGGFMTTVHAVTATQKIMDGPSGELQHN
GXAQNVIPAYTGTAQAVGKIIPDLNGKFTGMAFFVPTHNVSVIDLTCCLEKAAQHDDIKE
VTKQLSEGPLKGTLGYTEDQIVCCNFNRDTYSSTCDVGAGIAFNDHFVRLLSWYDNEFGY
SNIMVPRASKE
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggttttaagaataaggaagcgtcacattgtggatacatacagagccattaagaactgt
aatgcactctggtcctccccattcactagacagacacatcttctggtgcagggccagcag
tgtccccaagacacaatggtgaaggtcagagtaaacggatttggccatatcggatgcctg
gtcaccagggctgcttttaactctggaaaagtagatattgttgccatcagtgaccacttc
attgacctcaactacatggtcttcatgttttgttatgatttcacccatggcaaattccac
agcacagtcaaggctgagaatgggacacacgtcattaatggaaagcccatctccatcttc
caagagcgatattccaccaacagcaaatgggctgatgctggtgctaagtgtgctgtggag
tccactggggtctccaccaccatgaagactggagctcacctgacaggtgggatgaagagg
gtcatcctctctgccccttctgctgatgcccccatgtctgtgatgggtgtgaactgtgag
aagtatggcaactccttcaagatcgtcagcaacacctcctgcaccaccaactgcttggct
cctctggccgaggtcatctatgacaacttcagcattgtggggggattcatgaccacagtc
catgctgtcaccgccacccagaaaatcatggatggcccctctggggagctgcagcataat
ggcnntgcccagaatgtcatccctgcttatactggcactgcccaggctgtaggcaagatc
atccctgatctgaatgggaagttcactggcatggccttctttgtccccacccacaatgtg
tcagtcatcgatctgacctgctgcctggagaaagctgcccaacatgatgatatcaaagag
gtgacaaagcagttgtcagagggtcccctcaagggcaccctgggctacactgaggaccag
attgtctgctgcaactttaacagagacacctactcctccacctgtgatgttggggctggc
attgctttcaatgaccactttgtcaggctcctttcctggtatgacaatgaatttggctac
agcaacattatggtccccagagcctccaaggagtaa

KEGG   Felis catus (domestic cat): 109501341Help
Entry
109501341         CDS       T02385                                 

Definition
(RefSeq) glyceraldehyde-3-phosphate dehydrogenase, cytosolic-like
  KO
K00134  glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00010  Glycolysis / Gluconeogenesis
fca01100  Metabolic pathways
fca01200  Carbon metabolism
fca01230  Biosynthesis of amino acids
fca04066  HIF-1 signaling pathway
fca05010  Alzheimer disease
Module
fca_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
fca_M00002  Glycolysis, core module involving three-carbon compounds
fca_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109501341
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    109501341
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109501341
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    109501341
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    109501341
Enzymes [BR:fca01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.12  glyceraldehyde-3-phosphate dehydrogenase (phosphorylating)
     109501341
Membrane trafficking [BR:fca04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    109501341
Exosome [BR:fca04147]
 Exosomal proteins
  Proteins found in most exosomes
   109501341
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gp_dh_C
Motif
Other DBs
NCBI-GeneID: 109501341
NCBI-ProteinID: XP_019689553
Position
A1
AA seq 152 aa AA seqDB search
MAFRAPTPSVSVMDLACCLEKATKYNDIKKVVKQALEGPFKGILGFTEDQVVSCNFNSDT
HSSTFIARLALPSVTTFSRSFSGKIVNLARATGWQTLWSTWPSRNKGLLDYQPQQENKGK
TKVLSWWKVLAPTPLPTHCESPSLHEVSIHSF
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggccttccgggcccccacacccagtgtgtcagtcatggatctggcctgctgcctggag
aaagctaccaaatacaatgacatcaagaaagtggtgaagcaggcactggagggccccttc
aagggcatcctgggcttcactgaagaccaggttgtctcctgcaactttaacagtgacacc
cactcttccactttcattgctcgtctggcattgccctcagtgactactttttcaagatcg
ttttctggtaagatagtgaatttggctagagcaacagggtggcagaccttatggtccaca
tggccttcaaggaataagggactcctggactaccagccccagcaagagaacaaggggaag
acaaaggtcctcagttggtggaaagtccttgccccaactcctcttccaacacactgtgaa
tctcccagcctccacgaagtttctatccacagtttctaa

KEGG   Felis catus (domestic cat): 493876Help
Entry
493876            CDS       T02385                                 

Gene name
GAPDH
Definition
(RefSeq) glyceraldehyde-3-phosphate dehydrogenase
  KO
K00134  glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00010  Glycolysis / Gluconeogenesis
fca01100  Metabolic pathways
fca01200  Carbon metabolism
fca01230  Biosynthesis of amino acids
fca04066  HIF-1 signaling pathway
fca05010  Alzheimer disease
Module
fca_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
fca_M00002  Glycolysis, core module involving three-carbon compounds
fca_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    493876 (GAPDH)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    493876 (GAPDH)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    493876 (GAPDH)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    493876 (GAPDH)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    493876 (GAPDH)
Enzymes [BR:fca01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.12  glyceraldehyde-3-phosphate dehydrogenase (phosphorylating)
     493876 (GAPDH)
Membrane trafficking [BR:fca04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    493876 (GAPDH)
Exosome [BR:fca04147]
 Exosomal proteins
  Proteins found in most exosomes
   493876 (GAPDH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gp_dh_C Gp_dh_N DapB_N
Motif
Other DBs
NCBI-GeneID: 493876
NCBI-ProteinID: NP_001009307
Ensembl: ENSFCAG00000006874
UniProt: Q9N2D5
Position
B4
AA seq 333 aa AA seqDB search
MVKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPFIDLNYMVYMFQYDSTHGKFHGTVKA
ENGKLVINGKPITIFQERDPANIKWGDAGAEYVVESTGVFTTMEKAGAHLKGGAKRVIIS
APSADAPMFVMGVNHEKYDNSLKIVSNASCTTNCLAPLAKVIHDHFGIVEGLMTTVHAIT
ATQKTVDGPSGKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSV
VDLTCRLEKAAKYDDIKKVVKQASEGPLKGILGYTEDQVVSCDFNSDTHSSTFDAGAGIA
LNDHFVKLISWYDNEFGYSNRVVDLMAHMASKE
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaggtcggtgtgaacggatttggccgtattgggcgcctggtcaccagggctgct
tttaactctggcaaagtggacattgtcgccatcaatgaccccttcattgacctcaactac
atggtctacatgttccagtatgattccacccacggcaaattccacggcacagtcaaggct
gagaacgggaaacttgtcatcaatggaaagcccatcaccatcttccaggagcgagatccc
gccaacatcaaatggggtgatgctggtgctgagtatgttgtggagtctactggggtcttc
accaccatggagaaggctggggctcacttgaagggtggggccaagagggtcatcatctct
gccccttctgctgatgcccccatgtttgtgatgggcgtgaaccacgagaagtatgacaac
tctctcaagattgtcagcaatgcctcctgcaccaccaactgcctggcccctctggccaag
gtcatccatgaccacttcggcatcgtggagggactcatgaccacagtccatgccatcacc
gccacccagaagaccgtggacggcccctctgggaagctgtggcgtgatggccgaggggct
gcccagaacatcatccctgcttctactggcgctgccaaggctgtgggcaaggtcatccca
gagctgaatgggaagctcactggcatggccttccgtgtccccacccccaatgtgtccgtc
gtggatctgacctgccgcctggagaaagctgccaaatacgatgacatcaagaaggtggtg
aagcaggcatcagagggccccctcaagggcatcctgggctacactgaggaccaggttgtc
tcctgcgactttaacagtgacacccactcttccaccttcgacgctggggctggcattgcg
ctcaatgaccactttgtcaagctcatttcctggtatgacaatgaatttggctacagcaac
cgggtggtggacctcatggcccacatggcctccaaggagtaa

DBGET integrated database retrieval system