KEGG   Felis catus (domestic cat): 101084325Help
Entry
101084325         CDS       T02385                                 

Gene name
RPA1
Definition
(RefSeq) replication protein A 70 kDa DNA-binding subunit
  KO
K07466  replication factor A1
Organism
fca  Felis catus (domestic cat)
Pathway
fca03030  DNA replication
fca03420  Nucleotide excision repair
fca03430  Mismatch repair
fca03440  Homologous recombination
fca03460  Fanconi anemia pathway
Module
fca_M00288  RPA complex
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    101084325 (RPA1)
   03420 Nucleotide excision repair
    101084325 (RPA1)
   03430 Mismatch repair
    101084325 (RPA1)
   03440 Homologous recombination
    101084325 (RPA1)
   03460 Fanconi anemia pathway
    101084325 (RPA1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    101084325 (RPA1)
   03032 DNA replication proteins [BR:fca03032]
    101084325 (RPA1)
   03400 DNA repair and recombination proteins [BR:fca03400]
    101084325 (RPA1)
Transcription factors [BR:fca03000]
 Eukaryotic Type
  Zinc finger
   Other Cys4 zinc finger factors
    101084325 (RPA1)
DNA replication proteins [BR:fca03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    101084325 (RPA1)
DNA repair and recombination proteins [BR:fca03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     101084325 (RPA1)
   MMR (mismatch excision repair)
     101084325 (RPA1)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     101084325 (RPA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rep_fac-A_C REPA_OB_2 Rep-A_N tRNA_anti-codon DUF223
Motif
Other DBs
NCBI-GeneID: 101084325
NCBI-ProteinID: XP_006940040
Ensembl: ENSFCAG00000006306
UniProt: M3W5N4
Position
E1
AA seq 618 aa AA seqDB search
MVGHLSEGAIAAIMQQGDTSIKPVLQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLAT
QLNHLVEGEQLSSNCICQINRFIVNTLKDGRRVIILMELDILKSAEAVGLKIGNPVPYNE
GHGQQQVVPSPASAANPPASKPQQQNGSSGMGSTASKTYGASKTFGKAGATNLANIGSGG
TQVKVVPIASLTPYQSKWTICARVTNKSQIRTWSNSRGEGKLFSLELVDESGEIRATAFN
EQVDKFFPLIDMNKVYYISKGTLKIANKQFTAVKNDYEMTFNNETSVVPCEDGHHLPTVQ
FDFTAIGDLENKSKDSLIDIIGICKSYEDATKITVKSNNREVSKRDIYLMDMSGKVVTAT
LWGEDADRFDGSRQPVMAIKGARVSDFGGRSLSVLSSSTVIMNPDIPEAYKLRGWFDSEG
QALDGVSISDLKSGGTGGSNTNWKTLYEVKSENLGHGDKADYFSCVATVVFLRKENCMYQ
ACPAQDCFKKVIDQQNGLYRCEKCDSEFPSFKYRMILSANIADFQENQWVTCFQESAEAI
IGQTTAYIGELKEKNEQAFEEVFQNANFRTFIFKIRVKLETYNDESRIKATVMDVKPVDY
REYGKRLIMNIKRNALMM
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atggtgggccacctgagcgagggggccattgcggccataatgcaacagggagacacttcc
ataaaacctgtcctccaggtcattaacatccgtcccatcactacagggaatagtccaccc
cgttatcgactgcttatgagtgatggattgaacactctctcctctttcatgttggcaaca
cagttgaaccatctcgttgagggagaacaattgtctagcaactgtatttgccagattaac
cgatttattgttaacactctgaaagatggaaggagagtcattattttgatggagttagac
attttgaaatcagctgaagcagttggattaaagattggcaatcccgtgccctataatgaa
ggacacgggcagcagcaggtagttccttctccggcctcagcagccaacccgccagccagc
aagccccagcaacagaatgggagctcagggatgggttccactgcatctaagacttatggt
gcctcaaagacatttggaaaagctggagctaccaacctagcgaacataggttctggagga
acacaggtcaaagtggtacccatcgccagcctcaccccttaccaatccaagtggactatc
tgtgctcgagttaccaacaaaagtcagatccgtacctggagtaattcccggggggaaggg
aagctcttctccctagaactggttgatgaaagtggtgaaatcagagctactgctttcaac
gagcaagtggacaagttttttccccttattgacatgaacaaggtctattacatctctaaa
ggcaccctgaagattgctaacaaacagttcacagctgttaaaaatgactatgagatgacc
ttcaataatgagacttccgtcgtgccctgtgaagatggtcatcatttaccaacagttcag
tttgatttcacagcgattggtgacctggagaataagtctaaagattctctgatagacata
attgggatctgcaagagctatgaagatgccaccaaaatcacagtgaagtctaacaacaga
gaagtttcgaagagagacatctatttgatggacatgtcagggaaagtggtgaccgctact
ctgtggggagaagatgctgatagatttgatggttctagacaacctgtgatggctatcaaa
ggagccagagtttctgattttggtggacggagcctctctgtactgtcttcaagcacggtc
attatgaatcctgacatcccagaggcctataagcttcgtggatggtttgactctgaagga
caagccttagatggtgtttccatctctgatctaaagagtggaggaacaggaggtagcaac
accaactggaaaactctatatgaggttaaatcagagaacctaggccatggtgacaaggcc
gactattttagctgtgtggcgacagttgtgtttcttcgcaaagagaactgtatgtatcaa
gcctgcccagctcaggactgctttaagaaagtgattgatcaacagaatggattgtaccgc
tgtgagaagtgtgatagtgaatttcccagcttcaagtaccgcatgatcctgtcagcaaat
attgctgattttcaagagaatcagtgggtcacctgtttccaggagtctgcagaggccatc
attggacaaaccactgcttatattggggagttaaaagagaagaatgagcaagcatttgag
gaagttttccagaatgccaacttccgaactttcatattcaagatcagggtgaaactagag
acctacaatgatgagtctcgaattaaggccactgtgatggacgtgaagcccgtggactac
agagaatatggcaaaaggctgatcatgaacatcaagagaaacgcactgatgatgtga

KEGG   Felis catus (domestic cat): 101084979Help
Entry
101084979         CDS       T02385                                 

Gene name
RPA2
Definition
(RefSeq) replication protein A 32 kDa subunit
  KO
K10739  replication factor A2
Organism
fca  Felis catus (domestic cat)
Pathway
fca03030  DNA replication
fca03420  Nucleotide excision repair
fca03430  Mismatch repair
fca03440  Homologous recombination
fca03460  Fanconi anemia pathway
Module
fca_M00288  RPA complex
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    101084979 (RPA2)
   03420 Nucleotide excision repair
    101084979 (RPA2)
   03430 Mismatch repair
    101084979 (RPA2)
   03440 Homologous recombination
    101084979 (RPA2)
   03460 Fanconi anemia pathway
    101084979 (RPA2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:fca03032]
    101084979 (RPA2)
   03400 DNA repair and recombination proteins [BR:fca03400]
    101084979 (RPA2)
DNA replication proteins [BR:fca03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    101084979 (RPA2)
DNA repair and recombination proteins [BR:fca03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     101084979 (RPA2)
   MMR (mismatch excision repair)
     101084979 (RPA2)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     101084979 (RPA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPA_C tRNA_anti-codon MarR_2 TFA2_Winged_2
Motif
Other DBs
NCBI-GeneID: 101084979
NCBI-ProteinID: XP_006934534
Ensembl: ENSFCAG00000027743
UniProt: A0A2I2UEQ9
Position
C1
AA seq 270 aa AA seqDB search
MWFGGSESYGASFGGVGGGYTQSPGGFGMPTPSQAEKKSRARAQHIVPCTISQLLSATLV
DEVFRIGKVEISQVTIVGIIRHAEKAPTNIVYKVDDMTAAPMDVRQWVDTDDASSENTVV
PPETYVKVAGHLRSFQNKKSLVAFKIMPLEDMNEFTTHILEVVNAHMILSKANSQPLAGR
ATISNPGMGEAGNFGGNSAIPANGLTVAQNQVLSLIKACPRPEGLNFQDLKNQLQHMSVA
SIKQAVDFLSNEGHIYSTVDDDHFKSTDAE
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgtggtttggcggatctgaaagctatggcgcttcctttggcggagtcggcggcggctac
acacagtccccggggggcttcggaatgccgacaccttcccaggctgaaaagaaatcaaga
gcccgagcccagcacattgtaccctgtaccatatctcagctgctttctgccaccctggtc
gatgaagtgttcagaattgggaaggttgagatttcacaggtcactattgtgggtatcatc
agacatgcagagaaggctccaaccaacattgtttacaaagtagatgacatgacagctgca
cccatggatgttcgccagtgggttgacacagatgatgccagcagtgaaaacaccgtggtt
cctccagaaacgtatgtaaaagtggctggccatctgagatcctttcagaacaaaaaaagc
ctggtagcctttaagatcatgcctctggaggacatgaatgaattcaccacacatattctg
gaagtagtcaacgcacacatgatcctgagcaaagctaacagccagcccttagcagggaga
gcaactatcagcaatccaggaatgggtgaagcagggaactttggtgggaatagcgccata
ccagcaaatggcctcactgtggcccaaaaccaggtgctgagtttgattaaggcttgtcca
agaccagaaggattaaactttcaggatctcaagaaccagctccagcacatgtctgtagcc
tcaataaagcaagctgtagattttcttagcaacgagggacacatctattccactgtggac
gacgatcactttaaatccacagatgcagagtaa

KEGG   Felis catus (domestic cat): 101097223Help
Entry
101097223         CDS       T02385                                 

Gene name
RPA3
Definition
(RefSeq) replication protein A 14 kDa subunit
  KO
K10740  replication factor A3
Organism
fca  Felis catus (domestic cat)
Pathway
fca03030  DNA replication
fca03420  Nucleotide excision repair
fca03430  Mismatch repair
fca03440  Homologous recombination
fca03460  Fanconi anemia pathway
Module
fca_M00288  RPA complex
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    101097223 (RPA3)
   03420 Nucleotide excision repair
    101097223 (RPA3)
   03430 Mismatch repair
    101097223 (RPA3)
   03440 Homologous recombination
    101097223 (RPA3)
   03460 Fanconi anemia pathway
    101097223 (RPA3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:fca03032]
    101097223 (RPA3)
   03400 DNA repair and recombination proteins [BR:fca03400]
    101097223 (RPA3)
DNA replication proteins [BR:fca03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    101097223 (RPA3)
DNA repair and recombination proteins [BR:fca03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     101097223 (RPA3)
   MMR (mismatch excision repair)
     101097223 (RPA3)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     101097223 (RPA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rep_fac-A_3 DUF356
Motif
Other DBs
NCBI-GeneID: 101097223
NCBI-ProteinID: XP_004001453
Ensembl: ENSFCAG00000025369
UniProt: A0A2I2UN78
Position
A2
AA seq 121 aa AA seqDB search
MVDVMELPRSRINASMLARFIDQPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLD
EEISGIVEVVGRVTAKATILCASYVQFKEDNHPFDLGLYNEAVKITQEFPQFFPLGVVEY
D
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atggtggacgtcatggagttgcccaggtcgcgcatcaacgccagcatgctggctcggttc
atcgaccagccggtctgcttcgtagggaggctggaaaagattcatcccactggaaaaatg
tttattctttcagatggagaaggaaaaaatggaaccattgagttgatggagcctcttgat
gaagaaatctctggaattgtggaagtagttggaagagtaacagccaaagcaaccattctg
tgtgcatcttatgtccagtttaaagaagataaccatccttttgatcttggactttacaat
gaagctgtgaaaattacccaggaattccctcagttttttcctttgggagttgtggagtat
gattga

DBGET integrated database retrieval system