KEGG   Felis catus (domestic cat): 101084479Help
Entry
101084479         CDS       T02385                                 

Gene name
KCNA4
Definition
(RefSeq) potassium voltage-gated channel subfamily A member 4
  KO
K04877  potassium voltage-gated channel Shaker-related subfamily A member 4
Organism
fca  Felis catus (domestic cat)
Pathway
fca04927  Cortisol synthesis and secretion
fca04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    101084479 (KCNA4)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101084479 (KCNA4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:fca04040]
    101084479 (KCNA4)
Ion channels [BR:fca04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   101084479 (KCNA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans K_channel_TID BTB_2 Ion_trans_2 PKD_channel
Motif
Other DBs
NCBI-GeneID: 101084479
NCBI-ProteinID: XP_006937225
Ensembl: ENSFCAG00000031951
UniProt: M3XDS9
Position
D1
AA seq 654 aa AA seqDB search
MEVAMVSAESSGCNSHMPYGYAAQARARERERLAHSRAAAAAAVAAATAAVEGSGGSGGS
SHHHHQSRGACTSHDPQGSRGSRRRRRQRPEKRRVHHRQSSFPHCSDLMPSGSEEKILRE
LSEEEEEEEEEEEEEEEGRFYYSEDDHGDECSYTDLLPQDDGGGGGYSSVRYSDCCERVV
INVSGLRFETQMKTLAQFPETLLGDPEKRTQYFDPLRNEYFFDRNRPSFDAILYYYQSGG
RLKRPVNVPFDIFTEEVKFYQLGEEALLKFREDEGFVREEEDRALPENEFKKQIWLLFEY
PESSSPARGIAIVSVLVILISIVIFCLETLPEFRDDRDLIMALSAGGHSGLLNDTSAPHL
ENSGHTIFNDPFFIVETVCIVWFSFEFVVRCFACPSQALFFKNIMNIIDIVSILPYFITL
GTDLAQQQGGGNGQQQQAMSFAILRIIRLVRVFRIFKLSRHSKGLQILGHTLRASMRELG
LLIFFLFIGVILFSSAVYFAEADEPTTHFQSIPDAFWWAVVTMTTVGYGDMKPITVGGKI
VGSLCAIAGVLTIALPVPVIVSNFNYFYHRETENEEQTQLTQNAVSCPYLPSNLLKKFRS
STSSSLGDKSEYLEMEEGVKESLCAKEEKCQGKGDDSETDKNNCSNAKAVETDV
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atggaggttgcaatggtgagtgcggagagctcagggtgcaacagtcacatgccttatggt
tacgcggcccaggctagggcacgggagcgggagaggcttgctcactcgagggcagctgcg
gcagccgccgtggcagctgccacagctgctgtggagggcagtgggggttctggagggagc
tcccaccaccaccaccagtcgcgtggggcctgcacctcccatgaccctcagggcagccgg
ggtagtcggaggaggaggcgccagcggcctgagaagaggagagtccaccaccgccagagc
agctttcctcattgctccgacctgatgcccagtggctctgaggagaagattctgagggaa
ctgagtgaggaagaggaagaggaggaggaggaggaggaggaggaagaggaaggaaggttt
tactatagtgaggatgaccatggtgatgaatgttcctacacggacctgctgccccaggat
gacgggggcggcggtggctatagttcagtccgctacagtgactgttgtgaacgtgtggtg
ataaatgtgtcgggcctgcgctttgagacccagatgaagactctggcccagtttccagag
actttgttgggagaccctgagaagaggactcagtactttgaccctttgcgtaatgagtat
ttttttgacagaaacaggcctagctttgatgccatcttatattattaccaatcaggaggc
cgcctcaagaggccagtcaatgtcccctttgatatcttcactgaggaggtgaagttctat
cagttgggagaggaggccctgctcaagtttcgggaggacgagggttttgtgagagaagag
gaggacagggccttgccagagaatgaatttaaaaagcagatttggcttctgtttgagtat
ccggagagttccagtccagcaaggggcatagccatcgtctctgtcctggtcatcttaatc
tccattgtcattttctgcctggaaactttacctgagtttagggacgacagggatctcatc
atggcactgagtgcaggcgggcacagtgggttgttgaatgacacctcggcaccccaccta
gagaactcagggcacaccatcttcaacgaccccttcttcatcgtggagacagtctgtatt
gtttggttttccttcgagtttgttgttcgctgctttgcttgtcccagccaagcactcttc
ttcaaaaacatcatgaacatcattgacattgtatccattttgccttacttcatcaccctg
ggcactgatctggcccagcagcaggggggtggcaacggtcagcagcagcaggccatgtcc
ttcgctatcctcaggatcatccgtctggtccgagtattccggatcttcaaactctccagg
cattccaaaggcctgcagatcctgggccacaccctcagagccagcatgcgggagctggga
cttctgatcttcttcctcttcattggggtcatcctgttttccagtgctgtgtatttcgca
gaggcagatgaacctaccacccatttccaaagcatcccagatgcgttttggtgggccgtg
gtgaccatgacaactgtgggctatggggacatgaagcccatcactgtggggggcaagatc
gtggggtccctgtgtgccattgcaggtgtcttaaccattgctttgccagtgccagtgatt
gtctctaactttaactatttctaccacagagagactgagaatgaggaacagacacagctg
acacagaacgcagtcagttgcccatacctcccttctaatttgctgaagaaattccggagc
tctacttcttcttccctgggggacaagtcagagtatctagagatggaagaaggagttaag
gaatctctctgtgcaaaggaggagaagtgtcagggaaagggggacgacagtgagacagat
aaaaacaactgttctaatgcgaaggctgtggagactgatgtgtga

DBGET integrated database retrieval system