KEGG   Felis catus (domestic cat): 101084561Help
Entry
101084561         CDS       T02385                                 

Gene name
STAT1
Definition
(RefSeq) signal transducer and activator of transcription 1-alpha/beta
  KO
K11220  signal transducer and activator of transcription 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04062  Chemokine signaling pathway
fca04217  Necroptosis
fca04380  Osteoclast differentiation
fca04620  Toll-like receptor signaling pathway
fca04621  NOD-like receptor signaling pathway
fca04625  C-type lectin receptor signaling pathway
fca04630  Jak-STAT signaling pathway
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04917  Prolactin signaling pathway
fca04919  Thyroid hormone signaling pathway
fca04933  AGE-RAGE signaling pathway in diabetic complications
fca05140  Leishmaniasis
fca05145  Toxoplasmosis
fca05152  Tuberculosis
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05162  Measles
fca05164  Influenza A
fca05165  Human papillomavirus infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05200  Pathways in cancer
fca05212  Pancreatic cancer
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
fca05321  Inflammatory bowel disease (IBD)
Module
fca_M00684  JAK-STAT signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    101084561 (STAT1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101084561 (STAT1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101084561 (STAT1)
   04621 NOD-like receptor signaling pathway
    101084561 (STAT1)
   04625 C-type lectin receptor signaling pathway
    101084561 (STAT1)
   04658 Th1 and Th2 cell differentiation
    101084561 (STAT1)
   04659 Th17 cell differentiation
    101084561 (STAT1)
   04062 Chemokine signaling pathway
    101084561 (STAT1)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    101084561 (STAT1)
   04919 Thyroid hormone signaling pathway
    101084561 (STAT1)
  09158 Development
   04380 Osteoclast differentiation
    101084561 (STAT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101084561 (STAT1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101084561 (STAT1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101084561 (STAT1)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    101084561 (STAT1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101084561 (STAT1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101084561 (STAT1)
  09172 Infectious disease: viral
   05162 Measles
    101084561 (STAT1)
   05164 Influenza A
    101084561 (STAT1)
   05161 Hepatitis B
    101084561 (STAT1)
   05160 Hepatitis C
    101084561 (STAT1)
   05168 Herpes simplex virus 1 infection
    101084561 (STAT1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101084561 (STAT1)
   05169 Epstein-Barr virus infection
    101084561 (STAT1)
   05165 Human papillomavirus infection
    101084561 (STAT1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101084561 (STAT1)
   05140 Leishmaniasis
    101084561 (STAT1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    101084561 (STAT1)
Transcription factors [BR:fca03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   STAT
    101084561 (STAT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: STAT_alpha STAT_int STAT_bind STAT1_TAZ2bind SH2 TRPM_tetra DUF4407 DUF1633 BLI1
Motif
Other DBs
NCBI-GeneID: 101084561
NCBI-ProteinID: XP_006935505
Ensembl: ENSFCAG00000013725
UniProt: M3WJD7
Position
C1
AA seq 750 aa AA seqDB search
MSQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAANDVSFATIRFHDL
LSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPIQMSMIIYNCLKEERKILENAQ
RFNQAQSGNIQSTVMLDKQKELDSKVRNVKDKVMCIEHEIKTLEDLQDEYDFKCKTLQNR
EHETNGVAKNDQKQEQMLIKKMYLMLDSKRKEVVHKIIELLNITELTQKALINDELVEWK
QRQQSACIGGPPNACLDQLQNWFTIVAESLQQVRQQLKKLEELEQKYTYEHDPITKNKQG
LWDRTFNLFQQLIQSSFVVERQPCMPTHPQRPLVLKTGVQFTVKLRLLVKLQELNYNLKV
KVLFDKDVNERNTVKGFRKFNILGTHTKVMNMEESTNGSLAAEFRHLQLKEQKNAGTRTN
EGPLIVTEELHSLSFETQLCQPGLVIDLETTSLPIVVISNVSQLPSGWASILWYNMLVTE
PRNLSFFLNPPCARWSQLSEVLSWQFSSVTKRGLNVDQLNMLGEKLLGPNAGPDGLIPWT
RFCKENINDKNFPFWLWIESILELIKKHLLSLWNDGCIVGFISKERERALLKDQQPGTFL
LRFSESCREGAITFTWVERSQNGGEPYFHAVEPYTKKELSAVTFPDIIRNYKVMAAENIP
ENPLKYLYPNIDKDHAFGKYYSRPKEAPEPMELDGPKGTGYIKTELISVSEVHPSRLQTT
DNLLPMSPEEFDEVSRIVGPVEFDTMMNAV
NT seq 2253 nt NT seq  +upstreamnt  +downstreamnt
atgtctcagtggtatgagcttcagcagcttgactccaaattcctggaacaggttcaccag
ctctatgatgacagttttcccatggaaatcagacagtacctagcacagtggctagaaaag
caagactgggagcatgctgctaatgatgtttcatttgccaccatccgttttcatgacctc
ctatcacagctggatgatcagtacagtcgcttttctttggaaaataattttttgttgcag
cataacataaggaaaagcaagcgtaatcttcaggataattttcaggaagacccaatacag
atgtctatgattatctataactgtctgaaggaagaaaggaagatcctggaaaatgcccag
agattcaatcaggcgcagtcggggaatattcagagcactgtgatgttagacaaacagaag
gagcttgacagtaaagtcagaaatgtgaaggataaagttatgtgtatagagcatgaaatc
aagacactagaagacttacaagatgaatatgactttaaatgcaagaccttgcagaacaga
gaacatgaaaccaatggtgtggcaaagaatgatcagaagcaagaacagatgttaatcaag
aagatgtatttaatgcttgacagtaagagaaaggaagtagttcacaaaataatagagttg
ttgaacatcaccgaacttacccagaaagccctgattaatgatgaactggtggagtggaag
cagagacagcagagtgcctgtattgggggaccccccaacgcttgtcttgatcagctgcaa
aactggttcaccatagttgccgagagtctgcagcaggttcgtcagcagcttaaaaagctt
gaggaattggaacagaaatacacctatgaacacgaccctatcacaaaaaacaaacaaggg
ctgtgggaccgcaccttcaacctgttccaacagctcattcagagctcatttgtggtggaa
agacagccttgcatgccaactcatcctcagaggccactagtcttgaagactggggtccag
ttcaccgtgaagttgagactgttggtgaaattgcaggagctgaattataatttgaaagtc
aaagtcttatttgataaagatgtgaacgagagaaatacagtaaaaggatttagaaaattc
aacattctgggcacacatacaaaagtgatgaacatggaggaatccaccaacggaagtctg
gccgccgaatttcgacacctgcaactgaaagaacagaaaaatgctggcaccagaactaat
gagggccccctcatcgttacagaagagcttcactcccttagttttgaaacccagttgtgc
cagcctggtttggtcattgacctcgagacgacctctctgcccatcgtggtgatctccaat
gtcagccagctcccgagtggctgggcctccatcctgtggtacaacatgctggtgacagaa
cccaggaatctgtccttcttcctgaacccgccctgtgcacgatggtctcagctttcagag
gtgctgagttggcagttttcttctgtcaccaaaagaggtctcaatgtggaccagctgaac
atgctgggagagaagctacttggtcctaatgctggccccgatggtctcattccgtggacg
aggttctgcaaggaaaatataaatgacaaaaattttcctttctggctttggattgaaagc
atccttgaactcattaaaaaacacctgctctctctctggaatgatgggtgtatcgtgggc
tttatcagcaaggagcgagagcgtgccctgctgaaggatcagcagccagggacgttcctg
ctgcggttcagcgagagctgccgggaaggggccatcacgttcacgtgggtggagcggtcc
cagaacggaggggaaccttacttccacgcagtggaaccctacacgaagaaagaactttct
gctgttactttccctgatattattcgcaattacaaagtcatggcggctgaaaatattcca
gagaatcccctgaagtatctgtatccaaatattgataaggaccatgcctttgggaaatac
tactccaggccaaaggaagctccagaaccaatggaacttgatggccctaaaggaactgga
tacatcaagactgaattgatttctgtgtctgaagttcatccttctcgacttcagaccaca
gacaatcttctccccatgtctcctgaggagtttgacgaggtgtcccggatagtgggtcct
gtagaattcgacactatgatgaatgcagtatag

KEGG   Felis catus (domestic cat): 101099224Help
Entry
101099224         CDS       T02385                                 

Gene name
STAT2
Definition
(RefSeq) signal transducer and activator of transcription 2 isoform X1
  KO
K11221  signal transducer and activator of transcription 2
Organism
fca  Felis catus (domestic cat)
Pathway
fca04062  Chemokine signaling pathway
fca04217  Necroptosis
fca04380  Osteoclast differentiation
fca04621  NOD-like receptor signaling pathway
fca04625  C-type lectin receptor signaling pathway
fca04630  Jak-STAT signaling pathway
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05162  Measles
fca05164  Influenza A
fca05165  Human papillomavirus infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05200  Pathways in cancer
Module
fca_M00684  JAK-STAT signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    101099224 (STAT2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101099224 (STAT2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    101099224 (STAT2)
   04625 C-type lectin receptor signaling pathway
    101099224 (STAT2)
   04062 Chemokine signaling pathway
    101099224 (STAT2)
  09158 Development
   04380 Osteoclast differentiation
    101099224 (STAT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101099224 (STAT2)
  09172 Infectious disease: viral
   05162 Measles
    101099224 (STAT2)
   05164 Influenza A
    101099224 (STAT2)
   05161 Hepatitis B
    101099224 (STAT2)
   05160 Hepatitis C
    101099224 (STAT2)
   05168 Herpes simplex virus 1 infection
    101099224 (STAT2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101099224 (STAT2)
   05169 Epstein-Barr virus infection
    101099224 (STAT2)
   05165 Human papillomavirus infection
    101099224 (STAT2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    101099224 (STAT2)
Transcription factors [BR:fca03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   STAT
    101099224 (STAT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: STAT_alpha STAT2_C STAT_int STAT_bind SH2 KIP1
Motif
Other DBs
NCBI-GeneID: 101099224
NCBI-ProteinID: XP_003988942
Ensembl: ENSFCAG00000012023
Position
B4
AA seq 865 aa AA seqDB search
MAQWEMLQNLDNPFQDQLHQLYSNSLLPMDIRQCLAVWIEDQNWQDAAFGSDDSKANMLF
FHFLDQLNYECGRCSQNTECLLLRHNLRKFYRDIQAFPQGPTQLSEMIFNLLLEEKRILI
QAQRAQSEQEEPALEAPAESQQHEIESRILELTVMMEKLVKCICQLKDQQDVFCFRYKIQ
AQVKTPCLDPHQTRQQQLLQETLNELDKRRKEVLDAIKALLGRLTTLVELLLPRLEEWKI
QQQKACIGAPLNGGLEQLEKWFTAGAKLLFHLWQLLKELEGLRHLVSYQDDPLTKGVDLR
KAQVTELLQRLLHRAFVVETQPCMPQTPHRPLILKTGSKFTVQTRLLVRLQEGNELLTAE
VSIDRNPPQSQGFRKFNIMTSNQKTLTPEKGQSQGLIWDFGYLTLSEQRSGGSGKSCNKG
MLGVTEELHIISITVKYAYQGLKQELTTDTLPVVIISNMNQLSIAWASVLWFNLLSSNPQ
NQQFFSSPPKASWSLLGPALSWQFSSYVGRGLDSDQLNMLRNKLFGQNSRTEGAWLSWAD
FTKRESPPGKLPFWTWLDKILELVHDHLKDLWNDGHIMGFVSRSQERRLLKKTISGTFLL
RFSETSEGGITCSWVEHQDDDKVLIYSVQPFTKEVLQSLPLTKIIRDYQLLTEENIPENP
LRFLYPRIPRDEAFGCYYQEKVNLQERRKYLKHRLIVVSNRQVDELQQPLELKLEPEVES
LELEPGLAPVPQLEPCLELEPLLAAGLDLGPTLEPMPESTLEPMLEPTLDVVSQRVSEPN
LGPELKLEPIPDPVSQAVTEPEPDLPHDLRHLNTEEMEIFRNSMKIEEIMPNGDPLLAGQ
NTVDEAYVFHPSHFYTDGPLIPSDY
NT seq 2598 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagtgggagatgctacagaatctcgacaacccttttcaggatcagctacaccag
ctctactcaaatagcctcctgccaatggacattcgacaatgcttagctgtctggattgaa
gaccaaaactggcaggatgctgcatttggcagtgatgattccaaggctaacatgctgttc
ttccatttcttggaccaactgaattatgagtgtggccgctgcagccagaacactgagtgc
ttgttactacggcacaacttgagaaaattctatcgggacattcaggcctttccccagggc
cctacccagttgtctgagatgatctttaatctccttctggaagaaaaaagaattctgatc
caggctcagagggctcaatcggaacaggaagagccagccctcgaagcacctgcagagagc
cagcagcatgagattgaatccaggatcctggaattaacagttatgatggagaagctggtg
aaatgcatctgccagctgaaagaccagcaggatgtcttctgcttccgatataagatccag
gcccaagtgaagacaccctgtttggacccccatcagaccaggcagcagcagcttctgcag
gaaactcttaatgaactggacaaaaggagaaaggaggtactggatgccatcaaagcattg
ctaggccgattaactaccctcgttgagctactgctgcccaggttggaggaatggaaaatc
cagcagcagaaagcctgcattggagcccctctgaatggaggattggaacaactagagaag
tggttcacagctggagcaaagctgttgtttcacctgtggcagctgctgaaggagctggag
ggattgaggcacctggttagctatcaggatgatcctctgaccaaaggggtggacttgcga
aaggcccaggtcacggagttgctacagcgcctgctgcacagagcctttgtggtagaaacc
cagccctgcatgccccaaactccccatcgaccccttatcctcaagacagggagcaagttc
actgtccaaacaagattgctggtaagactccaggaaggcaacgagttactgactgcagaa
gtctccattgacaggaatcctcctcaatcacaaggcttccggaagttcaacattatgacc
tcaaaccagaaaactttgacccccgagaaggggcagagtcagggcttgatttgggacttc
ggctacctgactctctcggagcaacgttcaggtggttcaggaaagagctgcaataaggga
atgctgggtgtgacagaggaactacacattatcagcattacagtcaaatacgcctaccag
ggtctgaagcaggagctgacaacagacaccctccctgtggtgattatttctaacatgaac
caactctcaattgcctgggcctctgttctttggttcaatctgcttagctcaaacccacag
aatcagcagttcttctccagcccccccaaggcctcctggagcttgctgggccctgctctc
agttggcagttctcttcctatgttggccgaggccttgactcggaccagctgaacatgctg
aggaacaagctgtttgggcagaactccaggactgagggtgcatggttatcctgggctgac
ttcactaagcgagagagccctcctggcaagctaccattctggacatggttagacaaaatc
ttggagctggttcatgaccacctgaaggatctctggaatgatggacacatcatgggcttt
gtgagccggagccaggaacgccggctgctgaagaagaccatctcaggcacctttctgctg
cgcttcagtgaaacatcagaagggggcattacctgctcctgggtggaacaccaggatgat
gataaggtgctcatctactctgtgcagcccttcaccaaggaagtgctacagtctctccca
ctaaccaaaatcattcgcgactaccagctactcactgaggagaacatacccgagaaccca
ctgcgcttcctctacccccgaataccccgggatgaagcttttgggtgttactaccaggag
aaagttaatctccaagaacggaggaagtacctgaaacataggctcattgtggtctctaac
agacaggtggatgagctgcaacagccactggagctgaaactggagccagaagtggagtca
ctggagctagagccaggattggccccagtgccacagctagagccatgcctggagttagag
ccgctgctggcagcagggctggatctgggtccaaccctggagcccatgccagagtctact
ctggagcccatgctagagcccacactagatgtggtatcacaaagagtgtcagagccaaac
ttgggaccagaactgaagctggagcctattccagaccctgtatcacaggcagtgacagag
ccagagccggatttgccccatgatctgagacacttgaacaccgaggaaatggaaattttc
aggaacagtatgaagatcgaagaaatcatgccaaatggtgacccgctgttggctggccag
aacactgtggatgaggcttacgtcttccaccccagccatttctacacggatgggccctta
attccttctgactactag

DBGET integrated database retrieval system