KEGG   Felis catus (domestic cat): 101084752Help
Entry
101084752         CDS       T02385                                 

Gene name
AP2B1
Definition
(RefSeq) AP-2 complex subunit beta isoform X1
  KO
K11825  AP-2 complex subunit beta-1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04144  Endocytosis
fca04721  Synaptic vesicle cycle
fca04961  Endocrine and other factor-regulated calcium reabsorption
fca05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101084752 (AP2B1)
 09150 Organismal Systems
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    101084752 (AP2B1)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    101084752 (AP2B1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    101084752 (AP2B1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101084752 (AP2B1)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Clathrin-mediated endocytosis
   AP-2 complex
    101084752 (AP2B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Adaptin_N Cnd1 B2-adapt-app_C HEAT_2 HEAT Alpha_adaptinC2 Arm Cnd3 RTP1_C1 TIP120 Arm_2 Sec7_N
Motif
Other DBs
NCBI-GeneID: 101084752
NCBI-ProteinID: XP_023100195
Ensembl: ENSFCAG00000010390
Position
E1
AA seq 951 aa AA seqDB search
MTDSKYFTTNKKGEIFELKAELNNEKKEKRKEAVKKVIAAMTVGKDVSSLFPDVVNCMQT
DNLELKKLVYLYLMNYAKSQPDMAIMAVNSFVKDCEDPNPLIRALAVRTMGCIRVDKITE
YLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQMVEDQGFLDSLRDLIADSNPMVVANA
VAALSEISESHPNSNLLDLNPQNINKLLTALNECTEWGQIFILDCLSNYNPKDDREAQSI
CERVTPRLSHANSAVVLSAVKVLMKFLELLPKDSDYYNMLLKKLAPPLVTLLSGEPEVQY
VALRNINLIVQKRPEILKQEIKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLAELKE
YATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIRDIFRK
YPNKYESIIATLCENLDSLDEPDARAAMIWIVGEYAERIDNADELLESFLEGFHDESTQV
QLTLLTAIVKLFLKKPSETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVTAKEV
VLSEKPLISEETDLIEPTLLDELICHIGSLASVYHKPPNAFVEGSHGIHRKHLPIHHGST
DAGDSPVGTTTATNLEQPQVIPSQGDLLGDLLNLDLGPPVNVPQVSSMQMGAVDLLGGGL
DSLLGSDLGGGIGGSPAVGQSFIPSSVPATFAPSPTPAVVSSGLNDLFELSTGIGMAPGG
YVAPKAVWLPAVKAKGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFAIQFNKNSFGVIP
STPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLF
VEDGKMERQVFLATWKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDM
LYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKN
NT seq 2856 nt NT seq  +upstreamnt  +downstreamnt
atgactgactccaagtacttcacaaccaataaaaaaggagaaatctttgaattgaaggct
gaactcaacaatgaaaagaaagaaaagaggaaggaggctgtgaagaaggtgattgctgcc
atgactgtggggaaggatgttagctctctctttccagatgtagtgaactgtatgcaaacc
gacaatctggaattaaagaagcttgtgtacctttatttgatgaactacgccaagagtcag
ccagacatggccatcatggccgtcaacagctttgtgaaggactgtgaagatcctaatcct
ctcattcgggccttggcagtcaggaccatggggtgcatccgggtggacaagattacagaa
tatctgtgtgagcccctccgaaagtgtttgaaggatgaagatccctatgttcggaaaaca
gcagcagtctgtgtggcaaaactccatgatatcaatgcccaaatggtagaggatcaggga
tttctggattctctgcgggatctcatagcagattcaaatccaatggtggtggctaatgct
gtagcagcattgtctgaaatcagtgaatctcacccaaacagcaacctactcgatctgaac
ccacagaacattaataagctgctgacagccctgaatgaatgcactgaatggggccagatt
ttcatcttggactgcctttctaattacaaccctaaagatgaccgggaagctcagagcatc
tgtgagcgtgtgactccccggctatctcatgccaactcggcagtggtgctttcagcagta
aaagtcctgatgaagtttctggagttattacccaaggactctgactactacaatatgctg
ctgaagaagttggcccctccgcttgtcactttgctgtctggggagccagaggtgcagtac
gtcgccctgaggaatatcaatctaattgtccagaaaaggcctgaaatcttgaagcaggaa
atcaaagtcttctttgtgaagtacaatgatcccatctatgttaaactagagaaattggac
atcatgattcgtttggcatcccaagccaacattgctcaggttctggcagaattaaaggaa
tatgccacagaggtggatgttgactttgttcgcaaagctgtgcgggccattgggcggtgt
gccatcaaagtggagcaatctgcagagcgctgtgtgagcacattgcttgatctcatccag
accaaagtgaattatgtggtccaagaggcaattgttgtcatcagggacatctttcggaaa
taccccaacaagtatgaaagcatcattgccactctgtgtgagaacttagactcgctggat
gaaccagatgctcgagcagctatgatttggattgtgggagaatatgctgagagaattgac
aatgcagatgagttactggagagcttcctggaaggttttcatgatgaaagcacccaggtg
cagctcactctgcttactgccatagtgaagctgtttctcaagaaaccatcagaaacacag
gagctggtacagcaagtcttgagtttggcaacacaggattctgataatcctgaccttcga
gaccggggctatatttattggcgccttctctcaacggaccctgtcacagccaaagaagta
gtcttgtctgagaagccactgatctctgaggagacagatcttattgagccaactctgctg
gacgagctaatatgccacattggatccttggcctcggtataccataagcctcccaatgct
tttgtggaaggaagtcatggaatccatcgcaaacacttgccaatacatcatgggagcact
gatgcgggtgacagccctgttggcaccaccactgccaccaacctggaacagcctcaggtt
atcccctctcaaggtgaccttctaggagaccttttaaaccttgacctcggtccccccgtc
aatgtgccacaggtgtcctccatgcagatgggagcagtggatctcttgggaggaggtcta
gatagtctgcttggcagtgaccttggcgggggcattggaggaagtccggcagtgggacag
tcgttcatcccatcatcagtgcctgcaaccttcgctccttcacctactcctgctgtggtc
agcagtggtttgaacgacctgtttgaactctccacagggataggcatggcacctggtgga
tatgtggctcctaaggctgtctggctgcctgcagtaaaagctaaagggttggagatttct
ggaacatttactcaccgccaagggcacatctatatggaaatgaacttcaccaacaaagct
ctgcagcatatgacagattttgcaatccagtttaacaagaatagctttggtgtcatcccc
agcactcctctggccatccatacaccactgatgccaaaccagagcattgatgtctccctg
cctctcaacaccttgggcccagtcatgaaaatggagcctctgaataacctccaggtggct
gtgaaaaacaatattgatgtcttctacttcagctgcctcatcccactcaatgtgcttttt
gtagaagatggcaaaatggagcgccaggtcttcctcgcaacatggaaggatattcccaac
gaaaatgaacttcagtttcagattaaggaatgtcatttaaatgctgacactgtttccagc
aaattgcaaaacaacaacgtttatactattgccaagaggaatgtggaagggcaggacatg
ctgtaccaatccctgaagctcactaatggcatttggattttggctgagctacgtatccag
ccaggaaacccaaattatacgctgtcgctgaagtgcagagctcctgaagtctctcagtac
atctatcaggtctacgacagcattttgaaaaactaa

KEGG   Felis catus (domestic cat): 101088686Help
Entry
101088686         CDS       T02385                                 

Gene name
AP2M1
Definition
(RefSeq) AP-2 complex subunit mu isoform X2
  KO
K11826  AP-2 complex subunit mu-1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04144  Endocytosis
fca04721  Synaptic vesicle cycle
fca04961  Endocrine and other factor-regulated calcium reabsorption
fca05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101088686 (AP2M1)
 09150 Organismal Systems
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    101088686 (AP2M1)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    101088686 (AP2M1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    101088686 (AP2M1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101088686 (AP2M1)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Clathrin-mediated endocytosis
   AP-2 complex
    101088686 (AP2M1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Adap_comp_sub Clat_adaptor_s muHD
Motif
Other DBs
NCBI-GeneID: 101088686
NCBI-ProteinID: XP_003991910
Ensembl: ENSFCAG00000007789
UniProt: M3W8D5
Position
C2
AA seq 435 aa AA seqDB search
MIGGLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKR
SNIWLAAVTKQNVNAAMVFEFLYKMCDVMAAYFGKISEENIKNNFVLIYELLDEILDFGY
PQNSETGALKTFITQQGIKSQHQTKEEQSQITSQVTGQIGWRREGIKYRRNELFLDVLES
VNLLMSPQGQVLSAHVSGRVVMKSYLSGMPECKFGMNDKIVIEKQGKGTADETSKSGKQS
IAIDDCTFHQCVRLSKFDSERSISFIPPDGEFELMRYRTTKDIILPFRVIPLVREVGRTK
LEVKVVIKSNFKPSLLAQKIEVRIPTPLNTSGVQVICMKGKAKYKASENAIVWKIKRMAG
MKESQISAEIELLPTNDKKKWARPPISMNFEVPFAPSGLKVRYLKVFEPKLNYSDHDVIK
WVRYIGRSGIYETRC
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgataggaggcttattcatctataatcacaagggggaggtgctaatctcccgggtctac
cgagatgacatcgggaggaacgcagtggatgcctttcgggtcaatgttatccacgcccgg
cagcaggtgcgcagccctgtcaccaacatcgctcgcaccagtttcttccatgttaagcgg
tccaacatctggttggcagctgtcaccaagcagaatgtcaatgctgccatggtcttcgaa
ttcctctataagatgtgtgacgtaatggctgcctactttggcaagatcagcgaggagaac
atcaagaacaattttgtgctcatatatgagctactggatgagatcctggactttggctat
ccacagaattcagagacaggagcactgaaaaccttcatcactcagcagggtatcaagagc
cagcatcagacaaaagaagagcagtcccagatcaccagccaggtgaccgggcagattggc
tggcggcgggagggcatcaagtatcgccggaatgagctcttcttggatgtgctagagagt
gtgaaccttctcatgtccccacaggggcaggtgctgagtgcccatgtgtcaggccgggtg
gtgatgaagagctacctgagtggcatgcccgagtgcaagtttgggatgaatgacaagatt
gttattgagaaacagggcaaaggcacagctgatgaaacaagtaaaagtgggaagcaatca
attgccatcgatgactgtaccttccaccagtgtgtgcgactcagcaagtttgactctgaa
cgcagcattagcttcatcccaccagatggagagtttgagctcatgaggtatcgcaccacc
aaggacatcatccttcctttccgggtgatcccgctagtgcgggaagtgggacgcaccaag
ctggaggtcaaggtggttatcaagtccaatttcaagccctcattactggctcagaagatt
gaggtgaggatcccaaccccactgaacacaagcggggtacaggtgatctgcatgaagggg
aaggccaaatacaaggccagcgagaacgccatcgtgtggaagatcaagcgtatggcaggc
atgaaggaatcacagatcagcgcagagattgagcttctgcccaccaatgacaagaagaaa
tgggctcgacctcccatttccatgaactttgaggtgccattcgccccctctggcctcaag
gtgcgttacttgaaggtgtttgaaccgaagctgaactacagcgaccatgatgtcatcaaa
tgggtgcgctacattggccgcagtggcatttatgagacccgctgctag

KEGG   Felis catus (domestic cat): 101090159Help
Entry
101090159         CDS       T02385                                 

Gene name
AP2S1
Definition
(RefSeq) AP-2 complex subunit sigma
  KO
K11827  AP-2 complex subunit sigma-1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04144  Endocytosis
fca04721  Synaptic vesicle cycle
fca04961  Endocrine and other factor-regulated calcium reabsorption
fca05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101090159 (AP2S1)
 09150 Organismal Systems
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    101090159 (AP2S1)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    101090159 (AP2S1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    101090159 (AP2S1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101090159 (AP2S1)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Clathrin-mediated endocytosis
   AP-2 complex
    101090159 (AP2S1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Clat_adaptor_s Recep_L_domain
Motif
Other DBs
NCBI-GeneID: 101090159
NCBI-ProteinID: XP_023101106
Ensembl: ENSFCAG00000031554
Position
E2
AA seq 142 aa AA seqDB search
MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYR
RYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLA
GEIRETSQTKVLKQLLMLQSLE
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgatccgcttcatcctcatccagaaccgggcgggcaagacgcgcctggccaagtggtac
atgcagttcgatgacgacgagaaacagaagctgatcgaggaggtgcacgccgtggtcact
gtccgagatgccaaacacaccaactttgtggagttccggaacttcaagatcatttaccga
cgctacgctggcctctacttctgcatctgcgtggacgtcaatgacaacaacctggcctac
ctggaagccatccacaactttgtggaggtcttaaacgagtatttccacaacgtctgtgag
ctggacctggtgttcaatttctacaaggtttacacggtcgtggacgagatgttcctggcc
ggcgagatccgcgagaccagccagacgaaggtgctgaagcagctgctgatgctccagtcc
ctggagtga

KEGG   Felis catus (domestic cat): 101097097Help
Entry
101097097         CDS       T02385                                 

Gene name
AP2A2
Definition
(RefSeq) AP-2 complex subunit alpha-2 isoform X1
  KO
K11824  AP-2 complex subunit alpha
Organism
fca  Felis catus (domestic cat)
Pathway
fca04144  Endocytosis
fca04721  Synaptic vesicle cycle
fca04961  Endocrine and other factor-regulated calcium reabsorption
fca05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101097097 (AP2A2)
 09150 Organismal Systems
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    101097097 (AP2A2)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    101097097 (AP2A2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    101097097 (AP2A2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101097097 (AP2A2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101097097 (AP2A2)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Clathrin-mediated endocytosis
   AP-2 complex
    101097097 (AP2A2)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   101097097 (AP2A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Adaptin_N Alpha_adaptin_C Alpha_adaptinC2 Cnd1 HEAT_2 RIX1
Motif
Other DBs
NCBI-GeneID: 101097097
NCBI-ProteinID: XP_006937731
Ensembl: ENSFCAG00000013098
UniProt: M3WI80
Position
D1
AA seq 936 aa AA seqDB search
MPAVSKGDGMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVC
KLLFIFLLGHDIDFGHMEAVNLLSSNRYTEKQIGYLFISVLVNSNSELIRLINNAIKNDL
ASRNPTFMGLALHCIANVGSREMAEAFAGEIPKILVAGDTMDSVKQSAALCLLRLYRTSP
DLVPMGDWTSRVVHLLNDQHLGVVTAATSLITTLAQKNPEEFKTSVSLAVSRLSRIVTSA
STDLQDYTYYFVPAPWLSVKLLRLLQCYPPPEDPAVRGRLTECLETILNKAQEPPKSKKV
QHSNAKNAVLFETISLIIHHDSEPNLLVRACNQLGQFLQHRETNLRYLALESMCTLASSE
FSHEAVKTHIETVINALKTERDVSVRQRAVDLLYAMCDRSNAQQIVAEMLSYLETADYSI
REEIVLKVAILAEKYAVDYTWYVDTILNLIRIAGDYVSEEVWYRVIQIVINRDDVQGYAA
KTVFEALQAPACHENLVKVGGYILGEFGNLIAGDPRSSPLIQFHLLHSKFHLCSVPTRAL
LLSTYIKFVNLFPEVKTTIQDVLRSDSQLKNADVELQQRAVEYLRLSTVASTDILATVLE
EMPPFPERQSSILAKLKKKKGPDTATGLEEAKRERSAAVNGGPEPAPASAASTPSPSADL
LGLGAAPPAPAGPPPSSGGLLVDVFSDSPSAVAPLAPGSEDNFARFVCKNNGVLFENQLL
QIGLKSEFRQNLGRMFIFYGNKTSTQFLNFTPTLICSDDLQMNLSLQTKPVDPTVDGGAQ
VQQVVNIECVSDFTEAPVLNIQFRYGGTFQNVSVKLPITLNKFFQPTEMASQDFFQRWKQ
LSNPQQEVQNIFKAKHPMDTEITKAKIIGFGSALLEEVDPNPANFVGAGIIHTKTTQIGC
LLRLEPNLQAQMYRLTLRTSKETVSQRLCELLSEQF
NT seq 2811 nt NT seq  +upstreamnt  +downstreamnt
atgccggccgtgtcgaagggggacgggatgcggggcttggcggtcttcatctccgacatt
cgcaactgcaaaagtaaagaagcagaaataaagagaataaacaaagaactggcaaacatt
agatcaaaatttaaaggtgacaaggctctcgatggctacagtaaaaagaagtacgtctgc
aagttgctgttcatcttcctcctgggtcatgacattgactttgggcacatggaggccgtg
aacctgctgagctccaacagatacacggagaagcagatcggctacctcttcatctctgtg
ctggtgaactccaacagcgagctgatccggctcatcaacaacgccatcaagaacgacctg
gccagtcggaaccccaccttcatgggcctggccctgcactgcatcgccaacgtgggcagc
cgagagatggccgaggcgtttgctggggagattccgaaaatcctcgttgctggagacacc
atggacagcgtgaagcagagcgccgccctgtgtttgctgcgtttgtaccgaacgtctccc
gacctcgtccccatgggtgactggacgtcccgcgtggtgcacctcctcaacgaccagcat
ttgggtgtggtgaccgcggccaccagcctcattaccaccttggcccagaagaaccccgag
gagttcaagacttctgtctctctggccgtgtccaggttaagcaggattgtgacatctgca
tcaacagaccttcaggattatacctactattttgtcccggctccctggctgtccgtgaaa
cttctgaggttgctacagtgctatccacccccagaagaccctgcagtgcgaggccgcctg
accgagtgcctggagacgattctgaacaaagcccaggaaccaccaaagtcaaagaaagtg
cagcattccaatgccaagaacgctgtgctcttcgagaccatcagcctgatcatccaccac
gacagtgagccaaacctgctggtgcgcgcctgtaaccagctgggccagttcctgcagcac
cgggagaccaacctccgctacctggccctggagagcatgtgcacgctggccagctccgag
ttctcccacgaagccgtcaagacgcacatcgagacggtcatcaacgcgctgaagacggag
cgggacgtgagtgtgcggcagcgggccgtggacctcctctacgccatgtgtgaccgcagc
aacgcccagcagattgtggccgagatgctgagctacttggagacggccgactattccatc
cgggaagagattgtgctgaaagttgccatcttggcggagaagtacgccgtggactacacg
tggtacgtggacaccatcctgaacctgatccggatcgccggcgactacgtgagcgaagag
gtgtggtaccgcgtcattcagattgtcatcaaccgcgacgacgtgcagggctacgctgcc
aagacggtgttcgaggctcttcaggctccggcgtgccacgagaacctggtcaaagtggga
ggctacatcctgggagagtttggaaacttgatagctggggaccccagatccagccccctg
atccagttccacctgctgcactccaagttccacctgtgcagcgtccccaccagggcgctg
ctcttgtccacctacatcaagttcgtgaacctgttcccggaggtgaagaccaccattcag
gacgtgctgcgcagtgacagccagctgaagaacgccgacgtcgagctgcagcagcgggcc
gtggagtacctgcggctcagcacggtggccagcaccgacatcctggcgaccgtcctggag
gagatgccgccgtttccggagcgccagtcctccattctggccaagctcaagaagaagaag
ggcccggacacagccacgggtctggaggaggccaagcgggagaggagcgccgctgtcaac
gggggccccgagcctgccccggccagcgccgcgtccacgccttctccatcggcagacctc
ttgggtctgggggccgcgccccctgcgcctgcgggccccccaccgtcctccggcgggctg
ctcgtggatgtattctcagactcaccctctgcggtcgcgccactggctcccggctccgaa
gacaactttgccaggtttgtctgtaaaaataatggtgtgttgtttgaaaaccagttgctt
caaattggattgaagtctgaatttcggcagaatttaggtcggatgtttatattctatgga
aataagacctccacgcagttcttaaatttcactccaacactgatctgttcagacgacctt
cagatgaatctgagcttgcagaccaagcctgtggacccgaccgtggacggtggcgcgcag
gtgcagcaggtcgtcaacatagagtgcgtgtctgacttcacggaggcgcccgtcctcaac
atccagttccggtatggggggacttttcagaatgtgtccgtgaagctgcctatcactctc
aacaaatttttccagcccacagaaatggcttctcaggatttctttcagcgttggaagcag
ctgagcaatccccaacaggaagtgcagaacattttcaaagcaaagcatccgatggacaca
gaaatcaccaaagctaagatcattgggtttggttctgcgctccttgaagaagttgatccg
aatcctgcaaattttgtgggggctggcatcatccacaccaaaaccacccagattggatgc
ttgctgcgtttggagccaaatctgcaagcccagatgtaccgcctcacgctgcgcacaagt
aaagagaccgtctcccagaggttgtgcgaattgctgtcagagcagttttaa

KEGG   Felis catus (domestic cat): 101101430Help
Entry
101101430         CDS       T02385                                 

Gene name
AP2A1
Definition
(RefSeq) AP-2 complex subunit alpha-1 isoform X1
  KO
K11824  AP-2 complex subunit alpha
Organism
fca  Felis catus (domestic cat)
Pathway
fca04144  Endocytosis
fca04721  Synaptic vesicle cycle
fca04961  Endocrine and other factor-regulated calcium reabsorption
fca05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101101430 (AP2A1)
 09150 Organismal Systems
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    101101430 (AP2A1)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    101101430 (AP2A1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    101101430 (AP2A1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101101430 (AP2A1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101101430 (AP2A1)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Clathrin-mediated endocytosis
   AP-2 complex
    101101430 (AP2A1)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   101101430 (AP2A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Adaptin_N Alpha_adaptin_C Alpha_adaptinC2 Cnd1 HEAT_2 RIX1 Dymeclin
Motif
Other DBs
NCBI-GeneID: 101101430
NCBI-ProteinID: XP_011287992
Ensembl: ENSFCAG00000004429
UniProt: M3W262
Position
E2
AA seq 978 aa AA seqDB search
MPAVSKGDGMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVC
KLLFIFLLGHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSELIRLINNAIKNDL
ASRNPTFMCLALHCIANVGSREMGEAFAADIPRILVAGDSMDSVKQSAALCLLRLYKASP
DLVPMGEWTARVVHLLNDQHMGVVTAAVSLITCLCKKNPDDFKTCISLAVSRLSRIVSSA
STDLQDYTYYFVPAPWLSVKLLRLLQCYPPPEDAAVKGRLVECLETVLNKAQEPPKSKKV
QHSNAKNAILFETISLIIHYDSEPNLLVRACNQLGQFLQHRETNLRYLALESMCTLASSE
FSHEAVKTHIDTVINALKTERDVSVRQRAADLLYAMCDRSNAKQIVSEMLRYLETADYAI
REEIVLKVAILAEKYAVDYSWYVDTILNLIRIAGDYVSEEVWYRVLQIVTNRDDVQGYAA
KTVFEALQAPACHENMVKVGGYILGEFGNLIAGDPRSSPPVQFSLLHSKFHLCSVATRAL
LLSTYIKFINLFPETKATIQGVLRAGSQLRNADVELQQRAVEYLTLSSVASTDVLATVLE
EMPPFPERESSILAKLKRKKGPGAGSALDDGRRDPSSNDVNGGVEPTPSTVSTPSPSADL
LGLRAAPPPAAPPATSGAGNLLVDVFSDGPAAQPSLGPTPEEAFLSELEPPAPESPMALL
ADPAPAADPGPEDIGPPIPEADELLNKFVCKNNGVLFENQLLQIGVKSEFRQNLGRMYLF
YGNKTSVQFQNFSPTVVHPGDLQTQLAVQTKRVAAQVDGGAQVQQVLNIECLRDFLTPPL
LSVRFRYGGAPQSLTLKLPVTINKFFQPTEMAAQDFFQRWKQLSLPQQEAQKIFKANHPM
DAEVTKAKLLGFGSALLDNVDPNPENFVGAGIIQTKALQVGCLLRLEPNAQAQMYRLTLR
TSKEPVSRHLCELLAQQF
NT seq 2937 nt NT seq  +upstreamnt  +downstreamnt
atgcccgccgtctccaagggcgatgggatgcgggggctcgcggtgttcatctccgacatc
cggaactgtaagagcaaggaggcggagattaagagaatcaataaggaactggccaatatc
cgctctaagttcaaaggggacaaagccttggacggctacagtaagaaaaagtatgtgtgt
aaactgctgttcatcttcctgctggggcacgacattgactttgggcacatggaagctgtg
aacctgctcagctccaacaagtacacggagaagcaaataggttacctgttcatctcggtt
ctggtgaactcaaactccgagctgatccggctcatcaataacgccatcaagaatgacctg
gccagccgtaacccgaccttcatgtgcctggccctgcattgcatcgccaacgtgggcagc
cgtgagatgggcgaggcctttgccgctgacatcccacgcatcctggtggctggggacagc
atggacagcgtgaaacagagcgcggccctgtgcctgctgcgactctacaaggcctcgcct
gacttagtgcccatgggcgagtggacggcccgcgtggtgcacctgctcaacgaccagcac
atgggtgtggtcacggctgctgtcagcctcatcacctgtctctgcaagaagaacccggac
gactttaagacctgcatctccctggccgtgtctcgcctgagccggatcgtctcctcggcc
tccaccgacctccaggactatacctactacttcgtcccggcgccctggctctcggtgaag
cttctgcgtctgctgcagtgctacccgccgccagaggatgctgccgtgaagggacggctg
gtggagtgtctggagaccgtgctcaacaaggcccaggagccgcccaagtccaagaaggtc
cagcactccaacgccaagaacgccatcctcttcgagaccattagcctcatcatccactac
gacagtgagcccaacctcctggtgcgagcctgcaaccagctgggccagttcctgcagcac
cgggagaccaacctccgctacctggccctggagagcatgtgcacgctggccagctccgag
ttctcccacgaggcggtcaagacccacatcgacacggtcatcaatgccctcaagacggag
cgggacgtcagtgtgcgacaacgggcggccgacctcctctacgccatgtgcgaccggagc
aacgccaagcagatcgtgtcggagatgcttcggtacctggagacggccgactacgccatc
cgcgaagagatcgtcctgaaggtggccatcctggcggagaagtacgcggtagactacagc
tggtacgtggacaccatcctcaacctcatccgcatcgcgggcgactacgtgagtgaggag
gtgtggtaccgcgtgttgcagatcgtcaccaaccgcgatgacgtccagggctacgcggcc
aagaccgtctttgaggcgctccaggccccagcctgccacgagaacatggtgaaggtcggc
ggctacatcctcggggagtttgggaatctgattgctggggacccccgctccagccccccg
gtgcagttctctctgctgcactccaagttccacctgtgcagcgtggccacgcgggccctg
ctgctgtccacctacatcaagttcatcaacctcttcccggagaccaaggccaccatccag
ggcgtgctgcgggcgggctcccagctgcgcaacgctgacgtggagctccagcagcgcgcc
gtcgagtacctcacgctcagctcggtggccagcacggacgtcctggccacggtgctggag
gagatgccgcccttccccgagcgcgagtcgtccatcctggccaagctgaaacgcaagaag
ggccccggggccggcagcgccctggatgatggcaggagggaccccagcagcaatgacgtc
aacgggggcgtggagcccacccctagcactgtgtcaacgccctcgccctccgccgacctc
ctggggctgcgggcagcccctcccccagccgcacccccagcgacctcgggtgcagggaac
ctcctggtggacgtcttctccgacggcccggctgcccagcccagcctggggcccacgccc
gaggaggccttcctcagcgagctggagccgcctgcccctgagagccccatggctttgctg
gctgacccagctccagctgctgacccaggtcctgaggacatcggcccgcccatcccagaa
gcggatgagctgctgaataagttcgtgtgcaagaacaatggggtcctgtttgagaaccag
ctgctgcagattggagtcaagtccgagttccggcagaacttgggccgcatgtatctgttc
tatggcaacaagacatctgtgcagttccagaacttctcgcccactgtcgtccaccccggc
gacctccagactcagctggcggtgcagaccaagcgggtggccgcgcaggtggacggcggg
gcgcaggtgcagcaggtgctcaacatcgagtgtctgcgggacttcctgacgcccccgctc
ctatccgtgcgcttccggtacgggggcgccccccagtccctcaccctgaagctccccgtg
accatcaacaagttcttccagcccacagagatggcggcccaggacttcttccagcgctgg
aagcagctgagcctcccccaacaggaggctcagaaaatcttcaaagccaaccaccccatg
gatgcggaagtcactaaggcaaaactcttggggtttggctctgctctcctggacaatgtg
gacccgaaccccgagaacttcgtgggggctggaatcatccaaacgaaagccctgcaggtg
ggctgtctgctccggctggagcccaatgcccaggctcagatgtaccggctgaccctgcgc
acgagcaaggaacccgtctcccgtcacctgtgtgagctgctggcccagcagttctga

DBGET integrated database retrieval system