KEGG   Felis catus (domestic cat): 101084765Help
Entry
101084765         CDS       T02385                                 

Gene name
MAPK9
Definition
(RefSeq) mitogen-activated protein kinase 9 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
fca  Felis catus (domestic cat)
Pathway
fca01522  Endocrine resistance
fca04010  MAPK signaling pathway
fca04012  ErbB signaling pathway
fca04014  Ras signaling pathway
fca04024  cAMP signaling pathway
fca04068  FoxO signaling pathway
fca04071  Sphingolipid signaling pathway
fca04137  Mitophagy - animal
fca04140  Autophagy - animal
fca04141  Protein processing in endoplasmic reticulum
fca04210  Apoptosis
fca04215  Apoptosis - multiple species
fca04217  Necroptosis
fca04310  Wnt signaling pathway
fca04380  Osteoclast differentiation
fca04510  Focal adhesion
fca04530  Tight junction
fca04620  Toll-like receptor signaling pathway
fca04621  NOD-like receptor signaling pathway
fca04622  RIG-I-like receptor signaling pathway
fca04625  C-type lectin receptor signaling pathway
fca04657  IL-17 signaling pathway
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04664  Fc epsilon RI signaling pathway
fca04668  TNF signaling pathway
fca04722  Neurotrophin signaling pathway
fca04723  Retrograde endocannabinoid signaling
fca04728  Dopaminergic synapse
fca04750  Inflammatory mediator regulation of TRP channels
fca04910  Insulin signaling pathway
fca04912  GnRH signaling pathway
fca04914  Progesterone-mediated oocyte maturation
fca04917  Prolactin signaling pathway
fca04920  Adipocytokine signaling pathway
fca04926  Relaxin signaling pathway
fca04930  Type II diabetes mellitus
fca04931  Insulin resistance
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca04933  AGE-RAGE signaling pathway in diabetic complications
fca05132  Salmonella infection
fca05133  Pertussis
fca05142  Chagas disease (American trypanosomiasis)
fca05145  Toxoplasmosis
fca05152  Tuberculosis
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05164  Influenza A
fca05167  Kaposi's sarcoma-associated herpesvirus infection
fca05168  Herpes simplex infection
fca05169  Epstein-Barr virus infection
fca05200  Pathways in cancer
fca05210  Colorectal cancer
fca05212  Pancreatic cancer
fca05231  Choline metabolism in cancer
fca05418  Fluid shear stress and atherosclerosis
Module
fca_M00688  MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101084765 (MAPK9)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    101084765 (MAPK9)
   04010 MAPK signaling pathway
    101084765 (MAPK9)
   04012 ErbB signaling pathway
    101084765 (MAPK9)
   04310 Wnt signaling pathway
    101084765 (MAPK9)
   04668 TNF signaling pathway
    101084765 (MAPK9)
   04068 FoxO signaling pathway
    101084765 (MAPK9)
   04071 Sphingolipid signaling pathway
    101084765 (MAPK9)
   04024 cAMP signaling pathway
    101084765 (MAPK9)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    101084765 (MAPK9)
   04137 Mitophagy - animal
    101084765 (MAPK9)
  Cell growth and death
   04210 Apoptosis
    101084765 (MAPK9)
   04215 Apoptosis - multiple species
    101084765 (MAPK9)
   04217 Necroptosis
    101084765 (MAPK9)
  Cellular community - eukaryotes
   04510 Focal adhesion
    101084765 (MAPK9)
   04530 Tight junction
    101084765 (MAPK9)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    101084765 (MAPK9)
   04621 NOD-like receptor signaling pathway
    101084765 (MAPK9)
   04622 RIG-I-like receptor signaling pathway
    101084765 (MAPK9)
   04625 C-type lectin receptor signaling pathway
    101084765 (MAPK9)
   04658 Th1 and Th2 cell differentiation
    101084765 (MAPK9)
   04659 Th17 cell differentiation
    101084765 (MAPK9)
   04657 IL-17 signaling pathway
    101084765 (MAPK9)
   04664 Fc epsilon RI signaling pathway
    101084765 (MAPK9)
  Endocrine system
   04910 Insulin signaling pathway
    101084765 (MAPK9)
   04920 Adipocytokine signaling pathway
    101084765 (MAPK9)
   04912 GnRH signaling pathway
    101084765 (MAPK9)
   04914 Progesterone-mediated oocyte maturation
    101084765 (MAPK9)
   04917 Prolactin signaling pathway
    101084765 (MAPK9)
   04926 Relaxin signaling pathway
    101084765 (MAPK9)
  Nervous system
   04728 Dopaminergic synapse
    101084765 (MAPK9)
   04723 Retrograde endocannabinoid signaling
    101084765 (MAPK9)
   04722 Neurotrophin signaling pathway
    101084765 (MAPK9)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101084765 (MAPK9)
  Development
   04380 Osteoclast differentiation
    101084765 (MAPK9)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    101084765 (MAPK9)
   05231 Choline metabolism in cancer
    101084765 (MAPK9)
   05210 Colorectal cancer
    101084765 (MAPK9)
   05212 Pancreatic cancer
    101084765 (MAPK9)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    101084765 (MAPK9)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    101084765 (MAPK9)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101084765 (MAPK9)
   04931 Insulin resistance
    101084765 (MAPK9)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101084765 (MAPK9)
  Infectious diseases
   05132 Salmonella infection
    101084765 (MAPK9)
   05133 Pertussis
    101084765 (MAPK9)
   05152 Tuberculosis
    101084765 (MAPK9)
   05164 Influenza A
    101084765 (MAPK9)
   05161 Hepatitis B
    101084765 (MAPK9)
   05160 Hepatitis C
    101084765 (MAPK9)
   05168 Herpes simplex infection
    101084765 (MAPK9)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    101084765 (MAPK9)
   05169 Epstein-Barr virus infection
    101084765 (MAPK9)
   05145 Toxoplasmosis
    101084765 (MAPK9)
   05142 Chagas disease (American trypanosomiasis)
    101084765 (MAPK9)
  Drug resistance
   01522 Endocrine resistance
    101084765 (MAPK9)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101084765 (MAPK9)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101084765 (MAPK9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like APH RIO1 FTA2 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 101084765
NCBI-ProteinID: XP_023109751
Ensembl: ENSFCAG00000025302
Position
A1
AA seq 424 aa AA seqDB search
MSDSKCDSQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRP
FQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIH
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGELVKGCVIFQGTDHIDQWNKVIEQ
LGTPSADFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSESERDKIKTNQARDLLSN
MLVIDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEV
LDWEERSKNGVVKDQPSDAPVSSNATPSESSSINDISSMSTEQTLASDTDSSLDASTGPL
EGCR
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacagtaaatgtgatagtcagttttacagtgtgcaagtggcagactcaactttc
actgtcctgaaacgttaccagcagttgaaaccaattggctctggagcccaagggattgtt
tgtgctgcttttgatacagttcttgggataaatgttgcagtcaagaaactaagccgtcct
tttcagaatcaaacccatgcaaagagagcttatcgtgaactcgtcctcttaaaatgtgtc
aatcataaaaatataattagtttgttaaatgtgtttacaccacagaagactctagaagaa
tttcaagatgtgtatttggtcatggaattaatggatgctaacttatgtcaggttattcat
atggagttggaccatgaaagaatgtcctaccttctctaccagatgctctgtggtattaaa
catctgcattcagctggtataattcatagagatttgaaacctagcaacatcgtagtaaaa
tcagactgcacgcttaagatccttgactttggcctggcccggacagcatgcaccaacttc
atgatgaccccatacgtggtgacgcggtattatcgggcacccgaagtcatcctgggcatg
ggatacaaagagaatgttgatatctggtcagtggggtgcatcatgggagagctggtgaaa
ggttgtgtgatattccaaggcactgatcatattgatcagtggaataaagtcattgagcag
ctaggaacgccgtctgcggattttatgaagaaacttcagccgaccgtgaggaattatgta
gaaaacagaccaaagtaccccggaatcaaatttgaagaactcttcccagattggatattc
ccatcagaatctgaacgagacaaaataaaaacaaatcaagccagagatctgttatcgaac
atgttagtgatagaccctgacaagcgcatctctgtagacgaggctctgcgtcacccttac
attactgtttggtatgaccctgctgaagcagaagcgccaccacctcagatttatgatgcc
cagttggaagaaagagagcatgcaatcgaggagtggaaagagctgatttacaaagaagta
ctggactgggaagaaagaagcaagaatggtgttgtgaaagatcagccttcagatgcacca
gtaagtagcaacgccactccttccgagtcgtcctccatcaacgacatctcatccatgtca
accgagcagacgttggcctcagacacagacagcagccttgatgcctcgacgggacccctg
gaaggttgtcgatga

DBGET integrated database retrieval system