KEGG   Felis catus (domestic cat): 101084782Help
Entry
101084782         CDS       T02385                                 

Gene name
DVL1
Definition
(RefSeq) segment polarity protein dishevelled homolog DVL-1 isoform X1
  KO
K02353  segment polarity protein dishevelled
Organism
fca  Felis catus (domestic cat)
Pathway
fca04150  mTOR signaling pathway
fca04310  Wnt signaling pathway
fca04330  Notch signaling pathway
fca04390  Hippo signaling pathway
fca04550  Signaling pathways regulating pluripotency of stem cells
fca04916  Melanogenesis
fca04934  Cushing syndrome
fca05165  Human papillomavirus infection
fca05200  Pathways in cancer
fca05217  Basal cell carcinoma
fca05224  Breast cancer
fca05225  Hepatocellular carcinoma
fca05226  Gastric cancer
Module
fca_M00677  Wnt signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101084782 (DVL1)
   04330 Notch signaling pathway
    101084782 (DVL1)
   04390 Hippo signaling pathway
    101084782 (DVL1)
   04150 mTOR signaling pathway
    101084782 (DVL1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    101084782 (DVL1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    101084782 (DVL1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101084782 (DVL1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    101084782 (DVL1)
   05226 Gastric cancer
    101084782 (DVL1)
   05217 Basal cell carcinoma
    101084782 (DVL1)
   05224 Breast cancer
    101084782 (DVL1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101084782 (DVL1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101084782 (DVL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Dsh_C Dishevelled DIX PDZ DEP PDZ_6 PDZ_2 Shufflon_N
Motif
Other DBs
NCBI-GeneID: 101084782
NCBI-ProteinID: XP_011282703
Ensembl: ENSFCAG00000007627
UniProt: M3W823
Position
C1
AA seq 700 aa AA seqDB search
MAETKIIYHMDEEETPYLVKLPVAPERVTLADFKNVLSNRPVHAYKFFFKSMDQDFGVVK
EEISDDNAKLPCFNGRVVSWLVLAEGAHSDAGSQSTDGHTDLPPPLERTGGIGDSRPPSF
HPNVASSRDCMDNDTGTESMVSHRRERARRRNREEAARTNGHPRGDRRRELGLPADSAST
VLSSELESSSFIDSDEDDNTSRLSSSTEQSTSSRLIRKHKRRRRKQRLRQTDRASSFSSI
TDSTMSLNIITVTLNMERHHFLGISIVGQSNDRGDGGIYIGSIMKGGAVAADGRIEPGDM
LLQVNDINFESMSNDDAVRVLREIVSQTGPISLTVAKCWDPTPRSYFTIPRADPVRPIDP
AAWLSHTAALTGALPRYGTSPCSSAVTRTSSSSLTSSVPGAPQLEEAPLTVKSDMGAVVR
VMKLPDSGLEIRDRMWLKITIANAVIGADVVDWLYTHVEGFKERREARKYASSMLKRGFL
RHTVNKITFSEQCYYVFGDLCSNLAALNLNSGSSGASDQDTLAPLPHPAAPWPLGQGYPY
QYPGPPPCFPPAYQDPGFSYGSGSAGSQQSEGSKSSGSTRSAGGSSRRALGREKERRAAG
AGGSGSESDHAAPSGVAGSGWRERPASQLSRGSSPHSQASAAAPGLPPLYPLTKAYSAVG
GPPGGPPVRELAAVPPELTGSRQSFQKAMGNPCEFFVDIM
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atggcggagaccaagatcatctatcacatggatgaggaggagacgccgtacctggtcaag
ctgcccgtggcgcctgagcgcgtcactctggccgacttcaagaatgtgctcagcaaccgg
cccgtgcacgcttacaaattcttcttcaagtccatggaccaggacttcggggtggtaaag
gaggagatctctgatgataacgccaagctgccctgcttcaacggccgcgtggtctcctgg
ctggtcctggctgagggcgcgcactcggacgcagggtctcagagcactgatggccataca
gacctgcccccgcctcttgagaggacgggcggcattggggattcccggcccccttctttc
caccccaatgtagcgagcagccgtgattgcatggacaacgacactggcacggagtccatg
gtcagccaccggcgggagagagcccgacgccggaaccgcgaagaggctgcccggaccaat
gggcacccgaggggggaccggcggcgagagctggggctgcccgccgacagcgcgtccacc
gtgctgagcagtgagcttgagtccagtagtttcatcgactcagacgaggatgacaacaca
agccgactgagcagctccacggagcagagcacctcctcccggctcatccggaagcacaag
cgccggcggcggaagcagcgcctgcggcagacggaccgtgcctcttcctttagcagcatc
acggactctactatgtccctgaacatcatcaccgtcacgctcaacatggagaggcaccac
ttcctgggcatcagtatcgtggggcagagcaacgaccggggagacggcggcatctatatc
ggctccatcatgaagggcggggccgtggctgccgacggccgcattgagcccggggacatg
ctgttgcaggtgaatgacatcaatttcgagagcatgagcaacgatgacgctgtgcgggtg
ctgcgggagatcgtgtcccagacggggcccatcagcctcacggtggccaagtgctgggac
ccaaccccccggagctacttcaccatcccgagggctgacccggttcggcccatcgaccct
gccgcctggctgtcccacacggcggcgctgaccggagccctgccccgctacggtacgagc
ccctgctccagcgccgtcacgcgcaccagctcctcctcactaaccagctctgtgcccggc
gctccgcagctggaggaggcgccgctgacggtgaagagtgacatgggtgccgtggtgcgt
gtcatgaagctgccggactcgggcctggagatccgagaccgcatgtggctcaagatcacc
atcgccaatgccgtcatcggggcggacgtggtggactggctgtacacgcacgtggagggc
ttcaaggaacggcgcgaggcccgcaagtacgccagcagcatgctgaagcgtggcttcctg
cggcacacggtgaacaagatcaccttctcggagcagtgctactacgtcttcggggacctg
tgcagcaatctcgcagccctgaacctcaacagtggttccagtggggcctcggatcaggac
accctggccccgctgccccatccggccgccccctggcccctgggtcagggctacccctac
cagtacccgggccccccgccctgcttcccacccgcataccaggaccctggcttcagctac
ggcagcggcagtgctgggagtcagcagagtgaaggaagcaaaagcagtgggtccacccgg
agcgccggcggcagcagccggcgggcactgggccgcgagaaggagcgccgggcggctgga
gccggaggcagtggcagcgagtcggaccatgcagcaccgagtggggtcgctggcagcggc
tggagggagcgtccggctagtcagctcagccggggcagcagcccacacagtcaggcctcg
gccgccgccccggggctccccccactgtaccccctgacaaaggcatactcggcggtgggg
gggccgcctggggggccgcccgtccgggagctggctgctgttcccccagagctgacgggc
agccgccagtccttccagaaggccatgggaaacccctgtgaattttttgttgacatcatg
tga

KEGG   Felis catus (domestic cat): 101094385Help
Entry
101094385         CDS       T02385                                 

Gene name
DVL2
Definition
(RefSeq) segment polarity protein dishevelled homolog DVL-2 isoform X1
  KO
K02353  segment polarity protein dishevelled
Organism
fca  Felis catus (domestic cat)
Pathway
fca04150  mTOR signaling pathway
fca04310  Wnt signaling pathway
fca04330  Notch signaling pathway
fca04390  Hippo signaling pathway
fca04550  Signaling pathways regulating pluripotency of stem cells
fca04916  Melanogenesis
fca04934  Cushing syndrome
fca05165  Human papillomavirus infection
fca05200  Pathways in cancer
fca05217  Basal cell carcinoma
fca05224  Breast cancer
fca05225  Hepatocellular carcinoma
fca05226  Gastric cancer
Module
fca_M00677  Wnt signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101094385 (DVL2)
   04330 Notch signaling pathway
    101094385 (DVL2)
   04390 Hippo signaling pathway
    101094385 (DVL2)
   04150 mTOR signaling pathway
    101094385 (DVL2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    101094385 (DVL2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    101094385 (DVL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101094385 (DVL2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    101094385 (DVL2)
   05226 Gastric cancer
    101094385 (DVL2)
   05217 Basal cell carcinoma
    101094385 (DVL2)
   05224 Breast cancer
    101094385 (DVL2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101094385 (DVL2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101094385 (DVL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Dsh_C Dishevelled DIX PDZ DEP PDZ_6 PDZ_2 Shufflon_N
Motif
Other DBs
NCBI-GeneID: 101094385
NCBI-ProteinID: XP_003996208
Ensembl: ENSFCAG00000024333
Position
E1
AA seq 735 aa AA seqDB search
MAGSGAGGGGVGETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPAGAKYFFKSM
DQDFGVVKEEISDDSARLPCFNGRVVSWLVSSDNPQPEVAPPAHEPRAELAPPPPPLPPL
PPERTSGIGDSRPPSFHPNVSSSRENLEPETETESVVSLRRERPRRRDSSEHGAGGHRPG
GPSRLERHLAGYESSSTLMTSELESTSLGDSDDDDTMSRFSSSTEQSSASRLLKRHRRRR
KQRPPRLERASSFSSVTDSTMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIM
KGGAVAADGRIEPGDMLLQVNDVNFENMSNDDAVRVLRDIVHKPGPIVLTVAKCWDPSPQ
AYFTLPRNEPIQPIDPAAWVSHSAALTGTFPAYPGSSSMSTMTSGSSLPDGCEGRGLSIH
TDMASVTKAMAAPESGLEVRDRMWLKITIPNAFLGSDVVDWLYHHVEGFPERREARKYAS
GLLKAGLIRHTVNKITFSEQCYYVFGDLSGGCESYLVNLSLNDDGSSGASDQDTLAPLPG
ATPWPLLPTFSYQYPAPHPYSPQPPPYHELSSYTYGGGSASSQHSEGSRSSGSTRSDGGA
GRTGRPEERAPESKSGSGSESEPSTRGGSLRRGGDPGGAGDGGPPPSRGSSGGAPNLRAH
PGLHPYGPPPGMALPYNPMMVVMVPPPPPPVPPAVQPPGAPPVRDLGSVPPELTASRQSF
HMAMGNPSEFFVDVM
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcagcggcgcggggggcggtggtgtcggggagacgaaggtgatttaccacctg
gatgaagaagagaccccgtacctggtgaagattcccgtccccgcggagcgcatcaccctg
ggcgatttcaagagcgtcctgcagcggcccgcgggcgctaagtactttttcaagtcaatg
gatcaggatttcggggtggtgaaggaggagatttcagatgacagcgcccgcctcccctgc
ttcaacggaagggtggtgtcctggctggtgtcatcggataacccccaacccgaggtggct
cccccagcccacgagcctcgggccgagctggcgccaccgccgccaccgttaccccctttg
ccgccggagaggaccagtggcattggcgactccagacctccatccttccaccctaacgtg
tccagcagccgggaaaacctggagcccgagacggaaacggagtcggtggtgtctctgcgg
cgggaacggcctcgcaggagagacagcagtgagcatggcgcggggggccacaggcctggc
ggcccctcgaggctggagcgccacctggccgggtacgagagctcctcgacgctcatgacc
agcgagctggagagcaccagcctgggcgactctgacgacgacgacaccatgagcaggttc
agcagctccacggagcagagcagcgcctcccgcctcctgaagcgccaccggcggcggagg
aagcagcggccgccccgcctggagagggcctcgtccttcagcagcgtcaccgactccacc
atgtccctcaacatcatcacggtcacgctcaacatggagaagtacaacttcctgggcatc
tccatcgtgggccagagcaacgagcggggcgacggcggcatctacatcggctccatcatg
aaggggggcgccgtggcggccgacgggcgcatcgagccgggcgacatgttgctgcaggtg
aacgacgtgaacttcgagaacatgagcaatgacgacgcggtgcgggtgctgcgggacatc
gtgcacaagccgggccccatcgtgctgacggtggccaagtgctgggatccctctccccag
gcctacttcacccttcctcggaatgagcccatccagcccattgaccccgctgcctgggtg
tcccactccgccgcgctgacgggcaccttcccagcctatccgggctcctcgtccatgagc
accatgacatcggggtcctctctgcctgacggttgtgagggccggggtctctccatccac
acagacatggcgtctgtgaccaaggccatggcagctcccgaatctggactggaagttcgg
gaccgcatgtggctcaagatcaccatccctaacgccttcctgggctcggacgtagttgac
tggctttaccatcacgtggaaggctttcctgagcgccgggaggcccgcaaatacgccagc
gggctgctcaaggctggcctcatccgacacacggtgaacaaaatcaccttctctgagcag
tgctattacgtgttcggggacctcagtggcggctgtgagagctacctggtcaacctgtcc
ctgaacgatgacggttccagcggggcttcggaccaggacaccttggcccctctgcctggg
gcgaccccgtggcccctgctgcccaccttctcctaccagtacccggccccgcacccatac
agcccccagccgccaccctaccacgagctctcatcctacacctatggcgggggcagtgcc
agcagccagcacagcgaggggagccggagcagtgggtcaacacggagcgacgggggggcg
gggcgtacggggaggcccgaggagcgggcccccgagtccaagtccggtagcggcagtgag
tccgagccttccacccgggggggcagccttcggcggggcggggaccctggtggggctggt
gatgggggcccgcccccttccagaggctcttcggggggcgcgcccaatctccgagcccac
cccgggctgcatccctacggaccaccccctggcatggccctcccctacaatcccatgatg
gtggtcatggtgcccccgcccccgccccccgtgcctccagcagtgcagcccccgggggcc
cctccggtcagagacctgggctctgtgcccccggagctgaccgccagccgccagagcttc
cacatggccatgggcaaccccagtgagttctttgtggatgtcatgtag

KEGG   Felis catus (domestic cat): 101095675Help
Entry
101095675         CDS       T02385                                 

Gene name
DVL3
Definition
(RefSeq) segment polarity protein dishevelled homolog DVL-3 isoform X2
  KO
K02353  segment polarity protein dishevelled
Organism
fca  Felis catus (domestic cat)
Pathway
fca04150  mTOR signaling pathway
fca04310  Wnt signaling pathway
fca04330  Notch signaling pathway
fca04390  Hippo signaling pathway
fca04550  Signaling pathways regulating pluripotency of stem cells
fca04916  Melanogenesis
fca04934  Cushing syndrome
fca05165  Human papillomavirus infection
fca05200  Pathways in cancer
fca05217  Basal cell carcinoma
fca05224  Breast cancer
fca05225  Hepatocellular carcinoma
fca05226  Gastric cancer
Module
fca_M00677  Wnt signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101095675 (DVL3)
   04330 Notch signaling pathway
    101095675 (DVL3)
   04390 Hippo signaling pathway
    101095675 (DVL3)
   04150 mTOR signaling pathway
    101095675 (DVL3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    101095675 (DVL3)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    101095675 (DVL3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101095675 (DVL3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    101095675 (DVL3)
   05226 Gastric cancer
    101095675 (DVL3)
   05217 Basal cell carcinoma
    101095675 (DVL3)
   05224 Breast cancer
    101095675 (DVL3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101095675 (DVL3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101095675 (DVL3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Dsh_C Dishevelled DIX PDZ DEP PDZ_6 Shufflon_N
Motif
Other DBs
NCBI-GeneID: 101095675
NCBI-ProteinID: XP_011284349
Ensembl: ENSFCAG00000007788
Position
C2
AA seq 716 aa AA seqDB search
MGETKIIYHLDGQETPYLVKLPLPAERVTLADFKGVLQRPSYKFFFKSMDDDFGVVKEEI
SDDNAKLPCFNGRVVSWLVSAEGSHPEPAPFCADNPSELPPPMERTGGIGDSRPPSFHPH
AGGGSQENLDNDTETDSLVSAQRERPRRRDGPEHTTRLNGTAKGERRREPGGYDSSSTLM
SSELETTSFFDSDEDDSTSRFSSSTEQSSASRLMRRHKRRRRKQKVSRIERSSSFSSITD
STMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIMKGGAVAADGRIEPGDMLL
QVNEINFENMSNDDAVRVLREIVHKPGPITLTVAKCWDPSPRGCFTLPRSEPIRPIDPAA
WVSHTAAMTGTFPAYGMSPSLSTITSTSSSITSSIPDTERLDDFHLSIHSDMAAIVKAMA
SPESGLEVRDRMWLKITIPNAFIGSDVVDWLYHNVEGFTDRREARKYASNLLKAGFIRHT
VNKITFSEQCYYIFGDLCGNMANLSLHDHDGSSGASDQDTLAPLPHPGAAPWPMAFPYQY
PPPPHPYNPHPGFPELGYSYGGGSASSQHSEGSRSSGSNRSGSDRRKEKDPKAGDSKSGG
SGSESDHTTRSSLRGPRERAPSERSGPAASEHSHRSHHSMASSLRSHHTHPSYGPPGVPP
LYGPPMLMMPPPPAAMGPPGAPPGRDLASVPPELTASRQSFRMAMGNPSEFFVDVM
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atgggcgagaccaagatcatctaccacctggacgggcaggagacgccgtacctggtgaag
ctgcccctgcccgccgagcgcgtcaccttggcggactttaagggcgttctgcagcgaccc
agctataagttcttcttcaagtctatggacgacgatttcggagtggtgaaggaggaaatc
tctgacgacaatgccaagctgccctgcttcaatggccgggtggtgtcctggttggtgtct
gctgagggctcacacccagagcctgctcccttctgtgctgacaacccatcggaactgcca
ccacccatggaacgcacaggaggcattggggactcccggcccccatccttccaccctcat
gctggtggaggcagccaggagaacttggacaatgacacagagacagactccttggtgtca
gcccagcgtgagcggccacgcaggagggacggcccagaacacacaacccgactaaatgga
actgcaaagggggagcggcggcgagagccagggggttacgatagctcatccacccttatg
agcagcgagttagagaccaccagcttctttgattcggatgaggatgactccaccagcagg
ttcagcagctccacagagcagagcagcgcctcacgcctgatgagaagacataagcggcgg
cggaggaagcagaaggtttcgcggattgagcggtcctcgtccttcagcagcatcacggac
tccaccatgtcactcaacatcatcacagtcactctcaacatggaaaagtacaactttttg
ggcatctccattgtgggccaaagcaacgagcgtggtgatggaggcatctacatcggctct
atcatgaagggtggggctgtggctgcagatggacgcatcgagccaggagatatgctgtta
caggtaaacgagatcaactttgagaacatgagtaatgacgacgcagtccgggtactgcgg
gagattgtgcacaaaccggggcccatcaccctgactgtagccaagtgctgggacccaagt
ccacgtggttgcttcacactgcccaggagcgagcccatccggcccattgaccctgcagcc
tgggtctcccacactgcagccatgaccggcaccttccctgcctatggcatgagcccctcc
ctgagcaccatcacctccaccagctcttccatcaccagctccatccctgatacagaacgc
ctagatgacttccacctatccatccacagtgacatggccgccatcgtaaaagccatggcc
tcccctgaatctgggctggaggtccgtgaccgcatgtggctcaagattaccatccccaac
gctttcatcggctcagatgtggtagactggctgtaccacaacgtggaaggcttcactgac
cggcgagaggcccgcaaatatgccagcaacctgctgaaagccggcttcatccgccacact
gtcaacaagatcaccttctccgagcagtgctactacatcttcggtgacctctgtggcaac
atggccaacctgtccctccatgatcacgatggctccagcggcgcctctgaccaggacacg
ctggcccctttgccacacccaggggcagccccttggcccatggctttcccttaccagtac
ccgccgcccccgcacccctataaccctcacccaggcttcccagagctggggtacagctat
ggtgggggcagcgccagcagtcagcacagtgaaggcagccggagcagtggctccaaccgt
agcggcagtgaccgacggaaggagaaggacccgaaggcgggggactcaaagtctggcggc
agcggcagcgagtcggaccacacaacccgcagcagcctgcgggggccgcgggagcgggcg
cccagcgagcgctcaggtcctgccgccagcgagcatagccaccgcagccaccactcaatg
gccagcagcctgcgcagtcaccacacgcacccgagctacggcccccctggcgtgccccct
ctctacggcccccccatgctgatgatgccccctccgcccgcggccatggggcccccagga
gcccctccgggtcgcgacctggcctccgtgccccccgaactgacagccagcagacagtcc
ttccgcatggccatgggaaaccccagtgagttctttgtggatgtgatgtga

DBGET integrated database retrieval system