KEGG   Felis catus (domestic cat): 101084855Help
Entry
101084855         CDS       T02385                                 

Gene name
USP27X
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 27
  KO
K11366  ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.4.19.12]
Organism
fca  Felis catus (domestic cat)
Brite
Enzymes [BR:fca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     101084855 (USP27X)
Peptidases [BR:fca01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   101084855 (USP27X)
Transcription machinery [BR:fca03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     101084855 (USP27X)
Ubiquitin system [BR:fca04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    101084855 (USP27X)
Chromosome and associated proteins [BR:fca03036]
 Eukaryotic Type
  Histone modification proteins
   HAT complexes
    SAGA complex
     101084855 (USP27X)
    SLIK complex
     101084855 (USP27X)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH UCH_1 zf-UBP Peptidase_C98
Motif
Other DBs
NCBI-GeneID: 101084855
NCBI-ProteinID: XP_019679375
UniProt: M3X3Y8
Position
X
AA seq 817 aa AA seqDB search
MGKRDVPLRAQQPWELYLSGCGVQARPQNGPGPYRKRGLAAEAASARGLRREDSRGASPA
SAAASFSESLFWVQLSQPPRSLRPGGGHPRSAWPPCRHAQWPPEPCEQGEEPPPVEAEEV
EEAETAETAEKAERKVEAEAKVEGKVEAAGKVEAAGKVDTAGNVETAEGLGRQAELKLEP
EPEPVPEAEQEPKGEPKQELEDENPARSGGGGSSDEVPPPTLPSEPPRPPDPSPRRSRAP
RRRPRPRPQTRLRTPPQPRPRPPPRPRPRRGPGGGCLDVDFAVGPPGCSHVNSFKVGENW
RQELRVIYQCFVWCGTPETRKSKAKSCICHVCGTHLNRLHSCLSCVFFGCFTEKHIHEHA
ETKQHNLAVDLYYGGIYCFMCKDYVYDRDIEQIAKEEQGEALKLQASTSTEVSHQQCSMP
GLGEKYPTWETTKPELELLGHNPRRRRITSSFTIGLRGLINLGNTCFMNCIVQALTHTPI
LRDFFLSDRHRCEMPSPELCLVCEMSSLFRELYSGNPSPHVPYKLLHLVWIHARHLAGYR
QQDAHEFLIAALDVLHRHCKGDDAGKAANNPNHCNCIIDQIFTGGLQSDVTCQACHGVST
TIDPCWDISLDLPGSCTSFWPMSPGRESSVNGESHIPGITTLTDCLRRFTRPEHLGSSAK
IKCGSCQSYQESTKQLTMNKLPVVACFHFKRFEHSAKQRRKITTYISFPLELDMTPFMAS
SKESRMNGQLQLPTNSGNDENKYSLFAVVNHQGTLESGHYTSFIRHHKDQWFKCDDAVIT
KASIKDVLDSEGYLLFYHKQVLEHESEKVKEMNTQAY
NT seq 2454 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaaagggatgtgcctctccgggcccagcaaccttgggagctctacctctccgga
tgtggggtccaagcccgcccccagaatggacctggtccttatcggaaacggggcctggct
gccgaagcggcctccgctagggggctacggcgggaggattcccggggggcgtcgcctgct
tccgccgccgcctccttcagtgaaagtctcttttgggtccagctgtcacagccaccgcgc
tccctcaggccgggcgggggacaccccaggtctgcgtggcccccgtgccgccacgcccag
tggccgcccgagccctgcgagcagggggaggagccgccgccagtggaggcggaggaggta
gaggaggcggagacggcggagacggcggagaaggcggagaggaaggtggaggcggaggcg
aaggtggaggggaaggtggaggcggccgggaaggtggaggcggcggggaaggtggacacc
gccgggaacgtggagacagcggagggtctgggccgccaggctgagctcaagctggagccc
gaacccgagcccgtaccggaggcggagcaggagccgaagggggagccgaagcaggagctg
gaggatgagaacccagcgcggagcggcggtggcggcagcagcgacgaggttcctcccccc
acccttccctccgaacccccgcggccccccgatccctctccgcggcgcagtcgtgccccc
cgccgccgaccccggccgcggccacagacccggctccgtaccccgccgcagcctaggcca
cggcccccgccccggccccggccccggcgcggccctgggggcggatgcctggatgtggat
ttcgctgtaggtccaccaggctgttcccacgtgaacagctttaaggtgggagagaactgg
aggcaggaactgcgggtgatctaccagtgcttcgtgtggtgtggaaccccagagaccagg
aaaagcaaggcaaagtcgtgcatctgccatgtgtgtggcacccatttgaacagacttcac
tcttgcctttcttgtgtcttctttggctgcttcacagagaaacacattcatgagcacgcc
gagacaaaacaacacaacttagccgtagacctttattatggaggtatatactgctttatg
tgtaaggattatgtatatgacagagacattgagcaaattgccaaagaagagcaaggagaa
gctttgaaattacaggcctccacctcaaccgaggtttctcaccagcagtgttcaatgcca
ggactcggtgagaaatatccaacctgggagacaaccaaacccgagttagaacttctggga
cacaacccaaggagaagaagaatcacctccagctttaccatcggtttaagaggactaatc
aatcttggcaacacgtgctttatgaactgcatcgtccaggcccttacccatactccgatc
ctgagagatttcttcctgtccgacaggcacagatgtgaaatgccaagtcctgagttgtgt
ctggtctgtgagatgtcttcgctttttcgggagttgtattctggaaacccatctcctcac
gttccttataaattactgcacctggtatggatacacgctcgtcacttagcaggatacagg
caacaggatgcccacgagttcctcattgccgcgttagatgtcctgcacaggcactgcaaa
ggtgatgatgccgggaaggctgccaacaatcccaaccactgtaactgcatcatagaccaa
atcttcacaggtggcctgcagtctgatgtcacctgtcaagcctgccatggcgtctccacc
accatagacccatgctgggacatcagtttggacttgcctggctcttgcacctccttctgg
cccatgagcccagggagggagagcagtgtgaatggggaaagccacataccaggaatcacc
accctcacggactgcttgcgaaggtttacaaggccagagcacttaggtagcagtgccaaa
atcaaatgcggtagttgccaaagctaccaggaatctaccaaacagctcacgatgaataaa
ttacctgttgttgcctgttttcatttcaaacggtttgaacactcggccaaacagaggcgc
aagatcactacatacatatcctttcctctggagctggatatgacaccatttatggcctcg
agtaaagagagcaggatgaatggacagttgcagctgccaaccaatagtggaaacgatgag
aataagtattccttgtttgctgtggttaatcaccaaggaaccttggagagtggccactac
accagcttcatccggcaccacaaggaccagtggttcaagtgtgatgatgccgtcatcacc
aaggccagtattaaggacgttctggacagtgaagggtatttactgttctatcacaaacag
gtcctggaacatgagtcagaaaaagtgaaagaaatgaatacacaagcctactga

DBGET integrated database retrieval system