KEGG   Felis catus (domestic cat): 101085155Help
Entry
101085155         CDS       T02385                                 

Gene name
GOT1
Definition
(RefSeq) aspartate aminotransferase, cytoplasmic
  KO
K14454  aspartate aminotransferase, cytoplasmic [EC:2.6.1.1]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00220  Arginine biosynthesis
fca00250  Alanine, aspartate and glutamate metabolism
fca00270  Cysteine and methionine metabolism
fca00330  Arginine and proline metabolism
fca00350  Tyrosine metabolism
fca00360  Phenylalanine metabolism
fca00400  Phenylalanine, tyrosine and tryptophan biosynthesis
fca01100  Metabolic pathways
fca01200  Carbon metabolism
fca01210  2-Oxocarboxylic acid metabolism
fca01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101085155 (GOT1)
   00270 Cysteine and methionine metabolism
    101085155 (GOT1)
   00220 Arginine biosynthesis
    101085155 (GOT1)
   00330 Arginine and proline metabolism
    101085155 (GOT1)
   00350 Tyrosine metabolism
    101085155 (GOT1)
   00360 Phenylalanine metabolism
    101085155 (GOT1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    101085155 (GOT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:fca01007]
    101085155 (GOT1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101085155 (GOT1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101085155 (GOT1)
Enzymes [BR:fca01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     101085155 (GOT1)
Amino acid related enzymes [BR:fca01007]
 Aminotransferase (transaminase)
  Class I
   101085155 (GOT1)
Membrane trafficking [BR:fca04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    101085155 (GOT1)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101085155 (GOT1)
  Exosomal proteins of other body fluids (saliva and urine)
   101085155 (GOT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 101085155
NCBI-ProteinID: XP_011285783
Ensembl: ENSFCAG00000028066
UniProt: M3X6W4
Position
D2
AA seq 413 aa AA seqDB search
MAPPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCQPWVLPVVRKVEQK
IANDNSLNHEYLPILGLAEFRTCASRLALGDNSPALQEKRVGGVQSLGGTGALRIGAEFL
ARWYNGTNNKDTPVYVSSPTWENHNGVFSAAGFKDIRSYHYWDAAKRGLDLQGFLNDLEN
APEFSIFVLHACAHNPTGTDPTPEQWKQIAAVMKRRFLFPFFDSAYQGFASGDLEKDAWA
VRYFVSEGFELFCAQSFSKNFGLYNERVGNLTVVAKEPDSILRVLSQMEKIVRITWSNPP
AQGARIVACTLSNPELFKEWTGNVKTMADRILTMRSELRARLEALKTPGTWNHITEQIGM
FSFTGLNPKQVEYLVNEKHIYLLPSGRINMCGLTTKNLDYVATSIHEAVTKIQ
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atggcgcctccttctgtgttcgccgaggttccgcaggcgcagcccgtccttgtctttaag
ctcactgccgatttccgggaggatccggacccccgcaaggtcaacctgggagtgggagct
tatcgcacagatgactgccagccctgggttttgccagtcgtgaggaaggtggagcagaag
attgctaacgacaatagcctaaaccacgagtacctgccgatcctgggcctggcggagttc
cggacctgtgcgtcccgccttgcccttggggataacagcccagctctccaggagaagcgg
gtgggaggtgtccagtctttgggggggacaggtgcacttcgaatcggagctgagttccta
gcgcgatggtacaatggaacaaacaacaaggacacgcccgtctacgtgtcctcaccaacc
tgggagaatcataatggtgtattttctgccgctggatttaaagacattcggtcctatcac
tattgggacgcagcgaagagaggactcgatctccagggtttcctgaatgatctggagaat
gcccccgagttctccatctttgtcctccatgcctgtgcacacaacccaactgggactgac
ccaactccggagcagtggaagcagatcgccgccgttatgaagcgccggtttctgttcccc
ttctttgactcagcctatcagggctttgcatctggagaccttgagaaagacgcctgggct
gttcgctattttgtgtctgaaggatttgagctcttctgtgctcagtccttttccaagaac
ttcgggctctacaatgagcgagtgggcaatctgaccgtggttgcaaaagaacctgacagc
atcctgcgggtcctttcccagatggagaagatagtgcgaattacttggtccaatccccct
gctcagggagcgcgaattgtggcctgtaccctctctaaccctgagctctttaaagaatgg
acaggtaatgtgaagacaatggctgaccggattctgaccatgagatctgaactcagggca
cgcttagaagccctcaagactccaggaacctggaaccacatcactgagcaaattggaatg
ttcagcttcaccggcttgaaccccaagcaggttgaatatctggttaacgaaaagcacatc
tatctgctgccaagcggtcggatcaacatgtgtggcttaactactaaaaatctagattat
gtggccacctccattcatgaagcagtcaccaaaatccagtga

KEGG   Felis catus (domestic cat): 101090160Help
Entry
101090160         CDS       T02385                                 

Gene name
GOT2
Definition
(RefSeq) aspartate aminotransferase, mitochondrial
  KO
K14455  aspartate aminotransferase, mitochondrial [EC:2.6.1.1]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00220  Arginine biosynthesis
fca00250  Alanine, aspartate and glutamate metabolism
fca00270  Cysteine and methionine metabolism
fca00330  Arginine and proline metabolism
fca00350  Tyrosine metabolism
fca00360  Phenylalanine metabolism
fca00400  Phenylalanine, tyrosine and tryptophan biosynthesis
fca01100  Metabolic pathways
fca01200  Carbon metabolism
fca01210  2-Oxocarboxylic acid metabolism
fca01230  Biosynthesis of amino acids
fca04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101090160 (GOT2)
   00270 Cysteine and methionine metabolism
    101090160 (GOT2)
   00220 Arginine biosynthesis
    101090160 (GOT2)
   00330 Arginine and proline metabolism
    101090160 (GOT2)
   00350 Tyrosine metabolism
    101090160 (GOT2)
   00360 Phenylalanine metabolism
    101090160 (GOT2)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    101090160 (GOT2)
 09150 Organismal Systems
  09154 Digestive system
   04975 Fat digestion and absorption
    101090160 (GOT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:fca01007]
    101090160 (GOT2)
Enzymes [BR:fca01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     101090160 (GOT2)
Amino acid related enzymes [BR:fca01007]
 Aminotransferase (transaminase)
  Class I
   101090160 (GOT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 101090160
NCBI-ProteinID: XP_003998142
Ensembl: ENSFCAG00000025552
UniProt: M3XE42
Position
E2
AA seq 430 aa AA seqDB search
MALLHTGRVLSGVAAAFHPGLAAAASARASSWWTHVEMGPPDPILGVTEAFKRDTNSKKM
NLGVGAYRDDNGKPYVLPSVRKAEAQIAAKNLDKEYLPIAGLAEFCKASAELALGENNEV
LKSSRYVTVQTISGTGALRIGASFLQRFFKFSRDVYLPKPSWGNHTPVFRDAGMQLHSYR
YYDPKTCGFDFTGAIEDISKMPQQSVLLLHACAHNPTGVDPRPEQWKEIATVVKKNNLFA
FFDMAYQGFASGDGNKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTVVCKDADE
AKRVESQLKILIRPMYSNPPINGARIASTILTSPDLRKQWLQEVKGMADRIISMRTQLVS
NLKKEGSSHNWQHITDQIGMFCFTGLKPEQVERLTKEFSIYMTKDGRISVAGVTSGNVGY
LAHAIHQVTK
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgctgcacaccggccgcgtcctgtccggggtcgccgccgctttccacccgggc
ctcgctgccgcggcttctgccagagccagctcctggtggacccatgtggaaatggggccc
ccagatcccatcctgggagtcacagaagcctttaagagagacaccaacagcaaaaagatg
aatctgggagttggtgcctaccgggacgataatggaaagccttatgtgcttcctagtgtc
cggaaggcagaggcccagattgctgcaaaaaatttggacaaagaatacctgcccattgca
ggacttgctgaattttgtaaggcatctgcagaactagccctgggtgagaacaatgaagtg
ttgaaaagtagccggtatgtcaccgtgcagaccatttctggaaccggggccttgaggatt
ggagccagttttctgcaaagattttttaagttcagccgagatgtttatctgcccaaacca
tcctggggaaatcacacacccgtcttcagggacgctggcatgcagctacacagttatcga
tactatgaccccaagacatgtggctttgacttcacaggcgctatagaggacatttcgaaa
atgccacagcaaagtgttcttctcctgcatgcctgtgcccacaatcccacgggagtggac
cctcgccctgagcagtggaaggaaatagcaacagtggtaaagaaaaacaacctctttgca
ttctttgacatggcctaccaaggctttgccagcggtgatggtaacaaggatgcctgggct
gtacgccacttcatcgaacagggcattaatgtttgtctctgccaatcctatgccaagaac
atgggcttgtacggtgagcgtgtgggagccttcactgtggtctgcaaagatgctgatgaa
gccaaaagggtggagtcacagttgaagatcttgatccgtcccatgtattccaaccctcca
atcaacggggcccggattgcctcgaccatcctaaccagccctgacctgcgaaaacaatgg
ttgcaggaagtaaaaggcatggctgaccgcatcattagcatgaggactcagctggtctcc
aacctcaagaaggagggctcctctcacaactggcagcacatcactgaccagattggcatg
ttttgtttcacaggactgaagcctgaacaggtggagaggctgaccaaggaattctccatc
tacatgacaaaggatggccgcatctctgtggcaggagtcacctcgggcaacgtgggctac
cttgcccacgccattcaccaggtcaccaagtaa

DBGET integrated database retrieval system