KEGG   Felis catus (domestic cat): 101085210Help
Entry
101085210         CDS       T02385                                 

Gene name
SRF
Definition
(RefSeq) serum response factor
  KO
K04378  serum response factor
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04022  cGMP-PKG signaling pathway
fca05166  Human T-cell leukemia virus 1 infection
fca05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101085210 (SRF)
   04022 cGMP-PKG signaling pathway
    101085210 (SRF)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101085210 (SRF)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101085210 (SRF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    101085210 (SRF)
Transcription factors [BR:fca03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   MADS-box responders to external signals
    101085210 (SRF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRF-TF
Motif
Other DBs
NCBI-GeneID: 101085210
NCBI-ProteinID: XP_006931824
Ensembl: ENSFCAG00000025180
Position
B2
AA seq 512 aa AA seqDB search
MLPSQAGAAAALGRGSALGGSLNRTPTGRPGGGGGGGGGTRGANGGRVPGNGAGLGPGRL
EREAAAAATTTPAPTAGALYSGSEGDSESGEEEELGAERRGLKRSLSEMELGVVVGGPEA
AAAATGGYGPVSGAVSGAKPGKKTRGRVKIKMEFIDNKLRRYTTFSKRKTGIMKKAYELS
TLTGTQVLLLVASETGHVYTFATRKLQPMITSETGKALIQTCLNSPDSPPRSDPTTDQRM
SATGFEETDLTYQVSESDSSGETKDTPKPAFTVTNLPGTTSTIQTAPSTSTTMQVSSGPS
FPITNYLAPVSASVSPSAVSSANGTVLKSTGSGPVSSGGLMQLPTSFTLMPGGAVAQQVP
VQAIQVHQAPQQASPSRDSSTDLTQTSSSGTVTLPATIMTSSVPTTVGGHMMYPSPHAVM
YAPTSGLADGSLTVLNAFSQAPSTMQVSHSQVQEQGGVPQVFLTAPSGTVQIPVSAVQLH
QMAVIGQQAGSSSNLTELQVVNLDAAHSTKSD
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgttaccgagccaagctggggccgcggcggcgctgggccggggctcggccctggggggc
agcctgaaccggaccccgacggggcggccgggaggtggcggcggcggcggcggcgggact
cgcggggctaacgggggccgggttcccgggaacggcgcggggctcgggccgggccgcctc
gagagggaggctgcagcagcagcgacaaccaccccggcgcccaccgcgggggccctctac
agcggcagcgagggcgactcggagtcgggtgaggaggaggagctgggcgcggagcggcgc
ggcctgaagcggagcctgagcgagatggagctcggcgtggtggtcggtgggcccgaggcg
gcggcggcggccaccgggggctatgggccggtgagcggcgcggtgagcggggccaagccg
ggtaagaagactcggggccgcgtgaagatcaagatggagttcatcgacaacaaactgcgg
cgctacacgaccttcagcaagaggaagacgggcatcatgaagaaggcctatgagctgtcc
acgctgacagggacacaggtgctgttgctggtggccagtgaaacaggccatgtgtatacc
tttgccacccgcaaactgcagccaatgatcaccagtgagactggcaaggcactgattcag
acctgcctcaactcgccagactctccaccccgttcagaccccaccacagaccagagaatg
agtgccacgggctttgaagagacagacctcacctaccaggtgtcggagtccgacagcagt
ggggagaccaaggacacaccgaaacccgcgttcacagtcaccaacctgccgggtaccacc
tccaccatccaaacagcacccagcacctctaccaccatgcaagtcagcagcggcccctcc
ttccccatcacgaactacctggcaccagtgtctgctagcgtcagccccagcgctgtcagc
agtgccaacgggactgtgctgaagagtacaggcagtggccctgtctcctccggaggcctc
atgcagctgcctaccagcttcaccctcatgcccggtggggcagtggcccagcaggtccca
gtgcaggccattcaggtgcaccaggccccacagcaagcgtctccttctcgcgacagcagc
acagacctcacgcagacctcctccagcgggacagtgacattgcccgccaccatcatgacg
tcatccgtgcccacaactgtgggcggccacatgatgtaccctagtccccatgcggtgatg
tatgcacccacctcgggcttggctgatggcagcctcaccgtgctcaatgccttctcccag
gcgccatccaccatgcaggtgtcccacagccaggtccaggaacaaggtggtgtcccccag
gtgttcctgacggcaccatctgggacagtgcagatccctgtttctgcagttcagcttcac
cagatggctgtgatagggcagcaggctgggagcagcagcaacctcaccgagttacaggtg
gtgaacctggacgccgcccacagcaccaagagtgactga

DBGET integrated database retrieval system