KEGG   Felis catus (domestic cat): 101085347Help
Entry
101085347         CDS       T02385                                 

Gene name
CCNE2
Definition
(RefSeq) LOW QUALITY PROTEIN: G1/S-specific cyclin-E2
  KO
K06626  G1/S-specific cyclin-E1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04110  Cell cycle
fca04114  Oocyte meiosis
fca04115  p53 signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04218  Cellular senescence
fca04934  Cushing syndrome
fca05161  Hepatitis B
fca05162  Measles
fca05165  Human papillomavirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05169  Epstein-Barr virus infection
fca05200  Pathways in cancer
fca05203  Viral carcinogenesis
fca05206  MicroRNAs in cancer
fca05215  Prostate cancer
fca05222  Small cell lung cancer
fca05226  Gastric cancer
Module
fca_M00692  Cell cycle - G1/S transition
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    101085347 (CCNE2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101085347 (CCNE2)
   04114 Oocyte meiosis
    101085347 (CCNE2)
   04115 p53 signaling pathway
    101085347 (CCNE2)
   04218 Cellular senescence
    101085347 (CCNE2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101085347 (CCNE2)
   05206 MicroRNAs in cancer
    101085347 (CCNE2)
   05203 Viral carcinogenesis
    101085347 (CCNE2)
  09162 Cancer: specific types
   05226 Gastric cancer
    101085347 (CCNE2)
   05215 Prostate cancer
    101085347 (CCNE2)
   05222 Small cell lung cancer
    101085347 (CCNE2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101085347 (CCNE2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101085347 (CCNE2)
   05162 Measles
    101085347 (CCNE2)
   05161 Hepatitis B
    101085347 (CCNE2)
   05169 Epstein-Barr virus infection
    101085347 (CCNE2)
   05165 Human papillomavirus infection
    101085347 (CCNE2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:fca03032]
    101085347 (CCNE2)
   03036 Chromosome and associated proteins [BR:fca03036]
    101085347 (CCNE2)
DNA replication proteins [BR:fca03032]
 Eukaryotic Type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    101085347 (CCNE2)
Chromosome and associated proteins [BR:fca03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    101085347 (CCNE2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_N Cyclin_C
Motif
Other DBs
NCBI-GeneID: 101085347
NCBI-ProteinID: XP_019678467
Ensembl: ENSFCAG00000030963
UniProt: M3X5A2
Position
F2
AA seq 406 aa AA seqDB search
MSRRSSRLQAKQQQQPQPSQTDSPPEAQIIQAKKRKTAQDVKKRKEEVAKRHQYEIRNCW
PPVLSGGISPCIIIETPHKEIGTSDFSRFTNYRFKNLFINPSPLPDLSWGCSNDVWLNML
KKETRYVHDKHFEVLHSDLEPQMRSILLDWLLEVCEVYTLHRETFYLAQDFFDRFMLTQK
DINKNMLQLIGITSLFIASKLEEIYAPKLQEFAYVTDGACSEEDILRMELIILKALKWEL
CPVTVISWLNLFLQVDALKDAPKVLLPQYSQEKFIQIAQLLDLCILAIDSLEFQYRILAA
AALCHFTSIEVVKKASGLEWDNISECVDWMVPFASVVKSTSPVKLKIFKKISMEDRHNIQ
THTNYLAMLDEVNYVNTFQKGGQLSPVCSGGIMTPPKSTEKPPGKY
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagacgcagtagccgtttacaagctaagcagcagcagcaaccccagcccagccag
acggattcccctccagaagcccagataattcaggccaagaagagaaaaacagcccaggat
gtcaaaaaaagaaaagaggaggtcgccaagagacatcagtatgagattaggaattgttgg
ccacctgtattatctggagggatcagtccttgtataatcattgaaacaccccacaaagaa
ataggaacaagtgacttctccagatttacaaattacagatttaaaaatctttttattaat
ccttcacctttgcctgatttaagttggggatgctcaaatgatgtttggctaaacatgcta
aaaaaagagactagatatgttcatgacaaacattttgaagttctgcattctgacctggaa
ccacagatgaggtcaatacttctagactggcttttagaggtatgtgaagtatacacactt
catagagaaacattttacctcgcgcaagacttttttgacagatttatgttgacacaaaag
gatataaataaaaatatgcttcagctcattggaattacctcattattcattgcttccaaa
cttgaggaaatctatgctcctaagctccaagagtttgcttatgtcactgatggtgcctgc
agtgaagaggatatcttaagaatggaacttattatattaaaggctttaaaatgggaactc
tgtcctgtaacagtcatctcctggctaaatctcttcctccaagttgatgctcttaaagat
gctcctaaagttcttctacctcagtattctcaggaaaagttcattcaaatagctcagctt
ttagatctgtgtattctagccatcgactcattagaattccagtacagaatcctggctgcc
gctgccttgtgccattttacctctattgaagtggttaagaaagcctcaggtttggaatgg
gacaacatttctgaatgtgtagactggatggtgccttttgccagtgtagtaaaaagtact
agtcctgtgaagctgaagatttttaagaagatttctatggaagacagacacaatatccag
acacatacaaattatctggctatgctggatgaagtaaattatgtaaacacctttcaaaag
gggggacagttgtcaccagtgtgcagtggaggcattatgacaccaccgaagagcactgaa
aaaccaccaggaaaatactaa

KEGG   Felis catus (domestic cat): 101086192Help
Entry
101086192         CDS       T02385                                 

Gene name
CCNE1
Definition
(RefSeq) G1/S-specific cyclin-E1
  KO
K06626  G1/S-specific cyclin-E1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04110  Cell cycle
fca04114  Oocyte meiosis
fca04115  p53 signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04218  Cellular senescence
fca04934  Cushing syndrome
fca05161  Hepatitis B
fca05162  Measles
fca05165  Human papillomavirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05169  Epstein-Barr virus infection
fca05200  Pathways in cancer
fca05203  Viral carcinogenesis
fca05206  MicroRNAs in cancer
fca05215  Prostate cancer
fca05222  Small cell lung cancer
fca05226  Gastric cancer
Module
fca_M00692  Cell cycle - G1/S transition
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    101086192 (CCNE1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101086192 (CCNE1)
   04114 Oocyte meiosis
    101086192 (CCNE1)
   04115 p53 signaling pathway
    101086192 (CCNE1)
   04218 Cellular senescence
    101086192 (CCNE1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101086192 (CCNE1)
   05206 MicroRNAs in cancer
    101086192 (CCNE1)
   05203 Viral carcinogenesis
    101086192 (CCNE1)
  09162 Cancer: specific types
   05226 Gastric cancer
    101086192 (CCNE1)
   05215 Prostate cancer
    101086192 (CCNE1)
   05222 Small cell lung cancer
    101086192 (CCNE1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101086192 (CCNE1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101086192 (CCNE1)
   05162 Measles
    101086192 (CCNE1)
   05161 Hepatitis B
    101086192 (CCNE1)
   05169 Epstein-Barr virus infection
    101086192 (CCNE1)
   05165 Human papillomavirus infection
    101086192 (CCNE1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:fca03032]
    101086192 (CCNE1)
   03036 Chromosome and associated proteins [BR:fca03036]
    101086192 (CCNE1)
DNA replication proteins [BR:fca03032]
 Eukaryotic Type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    101086192 (CCNE1)
Chromosome and associated proteins [BR:fca03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    101086192 (CCNE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_N Cyclin_C Connexin50
Motif
Other DBs
NCBI-GeneID: 101086192
NCBI-ProteinID: XP_023101114
Position
E2
AA seq 410 aa AA seqDB search
MPRERRERDAKERDTMKEESGTDVSVRSRKRKANVAVFLQDPDEEIAKIDRTVRNQCSSQ
PWDGSSVCENPCSLIPTPDKEEDEPTYPSSTCGPQSFMPSRASPLPILNWANRDEVWKIM
LNKEKTYLRDKHFMQRHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMATQ
QNIVKTLLQLIGISSLFIAAKLEEIYPPKLHQFAYVTDGACSGEEILSMELIIMKALKWH
LSPLTIVSWLNVYMQVAYLNDLYEVLLPQYPQQIFIQIAELLDLCVLDVGCLEFPYGVLA
ASALYHFSSSELMQKVSGYQWCDIEKCVKWMVPFAMVIRETGSSKLKHFRGVPAEDAHNI
QTHINSLDLLDKAQAKKAILSEQNRISPLPTGVLTPPQSSKKQSSGQGTV
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgccgagggagagaagggagagggatgcaaaggaacgggacaccatgaaagaggaaagt
ggcaccgatgtctctgttcgctccaggaaaagaaaggcaaatgtggctgtttttttgcag
gatccagatgaagaaattgcaaaaattgacaggactgtgagaaaccagtgcagcagtcag
ccttgggatggcagttcagtgtgtgaaaacccctgctccttgattcctacacctgacaaa
gaagaggatgagccaacgtaccctagttccacctgtgggcctcagagtttcatgccctcc
agagcctcaccactgcctatactgaactgggcaaatagagacgaggtttggaaaatcatg
ttaaacaaggagaagacctacttacgggataagcactttatgcagcggcaccctctcctg
cagcctaaaatgcgagcaattcttctggattggttaatggaggtgtgtgaagtctataaa
cttcacagagagacattttacttggcacaggatttctttgatcggtatatggcaacacaa
caaaatatcgtaaaaacacttttacagcttattgggatttcatctttatttattgctgcc
aaacttgaggaaatctatcctccaaagctgcaccagtttgcatatgttacagatggggct
tgttcaggagaggaaattcttagcatggaattaatcattatgaaggcccttaagtggcac
ttaagtcccctgaccattgtgtcctggctgaatgtatatatgcaggttgcatatctaaat
gatttatatgaagtgctcctgccacagtatccccagcaaatcttcatacagattgcagag
cttttagatctttgtgtcctggatgttggctgcttagaatttccctatggtgtacttgct
gcttctgccttgtatcatttctcttcctctgaattgatgcaaaaggtttcagggtatcag
tggtgtgatatagagaagtgtgtcaagtggatggttccatttgcaatggtcataagggag
acaggaagttcaaaacttaagcacttcaggggagttcctgctgaagatgcacacaacatc
cagacccatataaacagcttggatttgctggacaaagcccaagcaaagaaagccatattg
tctgaacaaaacaggatttctcctctccccaccggggtcctcactcccccacagagcagc
aagaagcagagcagtgggcaggggacagtgtga

DBGET integrated database retrieval system