KEGG   Felis catus (domestic cat): 101085729
Entry
101085729         CDS       T02385                                 

Gene name
ASIC1
Definition
(RefSeq) acid-sensing ion channel 1 isoform X2
  KO
K04829  acid-sensing ion channel 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101085729 (ASIC1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:fca04040]
    101085729 (ASIC1)
Ion channels [BR:fca04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   101085729 (ASIC1)
SSDB
Motif
Pfam: ASC
Other DBs
NCBI-GeneID: 101085729
NCBI-ProteinID: XP_003988728
Ensembl: ENSFCAG00000009460
Position
B4
AA seq 557 aa
MPIQIFCSVSFSSGEEAPGPLGDVWGPHQRRQRDKSESEEEEKEKEAVRKKSREGDSPMD
LVAFANSCTLHGTSHIFVEGGPGPRQALWAVAFVLALGAFLCQVGDRVAYYLSYPHVTLL
DEVATTELAFPAVTLCNTNAVRLSQLSYPDLLYLAPMLGLDESDDPGVPLAPPGPEAFSG
EPFNLHRFYNRSCHRLEDMLLYCSYCGGPCGPHNFSVVFTRYGKCYTFNSGRDGRPRLKT
MKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPFIDQLGFGVAPGF
QTFVSCQEQRLIYLPPPWGTCKAVTMDSDFFDSYSITACRIDCETRYLVENCNCRMVHMP
GDAPYCTPEQYKECADPALDFLVEKDQEYCVCEMPCNLTRYGKELSMVKIPSKASAKYLA
KKFNKSEQYIGENILVLDIFFEVLNYETIEQKKAYEIAGLLGDIGGQMGLFIGASILTVL
ELFDYAYEVIKHKLCRRGKCQKEAKRSSADKGVALSLDDVKRHNPCESLRGHPAGMTYAA
NILPHHPARGTFEDFTC
NT seq 1674 nt   +upstreamnt  +downstreamnt
atgcccatccagatcttctgctctgtgtcattctcctctggagaggaagccccagggccc
ttgggagatgtttggggtccgcaccagcggcggcagcgggacaagtcagaatcagaagag
gaagagaaggaaaaggaggcagtgaggaagaagtctagagagggggattcgcccatggat
ttggtggcctttgccaacagctgcaccctgcatggcaccagccacatcttcgtggagggg
ggtccagggccgaggcaggccctgtgggcagtggcctttgttctggcactgggtgccttc
ttgtgccaggtaggggaccgcgttgcctattacctcagctacccgcacgtgactctgcta
gacgaggtggccaccacggagctggccttcccggcggtcaccctctgcaacactaatgct
gtgcggctgtcccagctcagctaccccgacttgctctacttggcccccatgctggggctg
gatgaaagtgatgaccctggggtgcctctggccccaccgggacctgaggccttctctggg
gagccctttaacctgcaccgcttctacaaccgctcttgccaccggctggaggacatgctg
ctctattgttcctactgcggggggccctgtggccctcacaacttctcggtggtcttcaca
cggtatggaaagtgctacacattcaactcgggccgagatgggcgtccacggctgaagacc
atgaagggtgggactggcaatgggctggagatcatgctggacatccagcaggacgagtac
ctgcccgtatggggagagactgatgagacgtccttcgaagcgggcatcaaagtgcagatc
cacagtcaggatgaacctcccttcatcgaccagctgggctttggtgtggccccagggttc
cagacctttgtgtcctgccaggagcagcggctcatctacctgcccccgccctggggcacc
tgcaaagctgttaccatggactcggatttcttcgactcctacagcataactgcctgccgc
atcgactgtgagacacgctacctggtggagaactgtaactgtcgcatggtgcacatgcca
ggggatgccccatactgcactccagaacagtacaaggagtgtgcggatcctgctctggac
ttcctggtggagaaggaccaggaatactgtgtgtgtgaaatgccctgcaacctaacccgc
tatggcaaggagctgtccatggtcaagatccccagcaaagcgtcagccaagtacctggcc
aagaagttcaacaagtctgagcagtacataggggagaacatcctggtgctggacattttc
tttgaagtcctcaactatgagactattgagcagaagaaggcctatgaaattgcagggctc
ctgggtgacattggaggccagatgggcctgttcattggggccagcatcctcacagtactg
gagctctttgactacgcctatgaggtcattaagcacaagctgtgcagaagaggaaagtgc
cagaaggaggccaaaaggagcagcgcggacaagggtgtggcccttagcctggatgacgtc
aaaagacataacccgtgtgagagcctccggggccatcctgccgggatgacgtatgctgcc
aacatcctacctcaccatccggcccgaggcacttttgaggactttacctgctga

DBGET integrated database retrieval system