KEGG   Felis catus (domestic cat): 101085980Help
Entry
101085980         CDS       T02385                                 

Definition
(RefSeq) cholesterol side-chain cleavage enzyme, mitochondrial isoform X1
  KO
K00498  cholesterol monooxygenase (side-chain-cleaving) [EC:1.14.15.6]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00140  Steroid hormone biosynthesis
fca01100  Metabolic pathways
fca04913  Ovarian steroidogenesis
fca04925  Aldosterone synthesis and secretion
fca04927  Cortisol synthesis and secretion
fca04934  Cushing syndrome
Module
fca_M00107  Steroid hormone biosynthesis, cholesterol => prognenolone => progesterone
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    101085980
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    101085980
   04925 Aldosterone synthesis and secretion
    101085980
   04927 Cortisol synthesis and secretion
    101085980
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101085980
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:fca00199]
    101085980
Enzymes [BR:fca01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.6  cholesterol monooxygenase (side-chain-cleaving)
     101085980
Cytochrome P450 [BR:fca00199]
 Cytochrome P450, animal type
  CYP11 family
   101085980
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 101085980
NCBI-ProteinID: XP_003987006
UniProt: M3WE36
Position
B3
AA seq 520 aa AA seqDB search
MLAKGFPLRSVLVKGCQPLLNTAREGPGHPRVPTGDGAGISTQIPRPFSEIPSPGNNGWL
NLYNFWRETGSQKIHYHQLQNFQKYGPIYREKLGSMESVYIIDPEDVALLFKFEGPTPER
FSIPPWVAYHQHCQRPLGVLLKKSGAWKKDRLALNQEVMSPEAIKNFIPLLDPVSQDFVK
VLHRRIKLQGSGKFSGDISDNLFRFAFESITNVMFGERLGMLEEVVDPDAQRFIDAVYQM
FHTSVPMLSFPPDLFRLFKTKTWRDHVAAWDVIFNKAEAYTQNFYWDLRHKRDFNNYPCI
LQRLLRSHKLLFEDVKANITEMLAGGVDTTSMTLQWHLYEMARSLKVQEMLREEVRAARH
QAQGDISMMLQHVPLLKASIKETLRLHPISVTLQRYLENDLVLRNYMIPAKTLVQVSTYA
LGQDPTFFLNPGKFDPTRWLSKDKELIHFRNLGFGWGVRQCVGRRIAELEMTLFLIHILE
NFRVEMQHLSDVGTIFNLILMPDKPILLTFRPYSQDPPQV
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgctggccaaggggttccctcttcgctcagtcctggtcaaaggctgccagcccctcctg
aacaccgcacgggagggtccagggcatcccagggtgcccactggggatggggctgggatc
tccactcagattccccgccccttcagcgagatcccctccccgggaaacaacggctggcta
aacttgtacaatttctggagggagacgggctcacagaaaatccactatcaccaactccag
aacttccagaagtatggccccatttacagggagaagctgggcagcatggagtcggtttat
atcatcgaccctgaagatgtggcccttctctttaagttcgagggtcccactccagaacga
ttttccatcccaccgtgggtggcctatcaccagcattgccagagacccctcggcgtcctg
ttgaagaagtcaggagcttggaagaaagaccgactggccctgaaccaggaggtgatgtct
ccagaggccataaagaacttcatccccctgctggacccagtgtctcaggactttgtgaaa
gtcctgcacaggcgcatcaagctgcagggctccggaaagttctcaggggacatcagcgac
aacctgtttcgctttgcctttgagtccatcaccaacgtcatgttcggggagcgcctgggg
atgctggaggaggtggtggaccctgacgcccagcggttcatcgacgctgtctaccagatg
ttccacaccagtgtccccatgctcagcttccccccagacctgttccgtctattcaagacc
aagacctggagggaccatgtggctgcgtgggatgtgattttcaataaagcggaggcatac
acccagaacttctactgggacctgaggcacaagagagatttcaacaattacccctgcatc
ctccaacgcctcctaagaagtcacaagctgctctttgaggatgtcaaggccaacataaca
gagatgttggcagggggtgtggacacgacgtccatgacactgcagtggcacttgtacgag
atggcacgcagcctgaaggtgcaggagatgctgcgggaggaggtccgggctgcccggcac
caggcccagggagacatcagcatgatgttgcagcacgtcccgctcctcaaagccagcatc
aaggagacactgagactccaccccatctccgtgaccctgcagagataccttgaaaatgac
ttggttcttcgaaattacatgatccccgccaagacattggtgcaggtgtccacctatgcc
ttgggccaagaccccaccttcttcctcaatccgggcaagtttgacccaacccgatggctg
agtaaagacaaggaactcatccacttccggaacctgggctttggctggggtgtgcggcag
tgtgtgggccggcggatcgctgagctcgagatgaccctcttcctcatccatattctggag
aacttcagagttgaaatgcaacatctcagtgatgtgggcaccatattcaacctcatcctg
atgcccgacaagcccatcctcctcaccttcaggccctacagccaggacccaccccaggtg
tga

DBGET integrated database retrieval system