KEGG   Felis catus (domestic cat): 101086008Help
Entry
101086008         CDS       T02385                                 

Definition
(RefSeq) N-lysine methyltransferase KMT5A
  KO
K11428  histone-lysine N-methyltransferase SETD8 [EC:2.1.1.43]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    101086008
Enzymes [BR:fca01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101086008
Chromosome and associated proteins [BR:fca03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101086008
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 101086008
NCBI-ProteinID: XP_023097100
Ensembl: ENSFCAG00000029172
Position
D3
AA seq 244 aa AA seqDB search
MKSEEQKIKDAGRGPLAPFPNQKSEAAEPPKTPTSSCDPPVAAVAKQALKKPVKGKQAPR
KKAQGKTQQNRKLTDFYPVRRSSRKSKAELQSEERKRIDELIESGKEEGMKIDLIDGKGR
GVIATKQFSRGEFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATR
ETNRLGRLINHSKCGNCQTKLHDIDGVPHLILIASRDIKAGEELLYDYGDRSRASIEAYP
WLKH
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgaagtccgaggaacagaagatcaaagacgccgggaggggtcccctggcaccttttcca
aaccaaaaatctgaagcagcagaacctccaaaaactccgacctcgtcttgtgaccctccc
gtcgcagccgtcgccaagcaggccctgaaaaagcccgtcaagggcaaacaggcccctcgg
aagaaagctcaaggaaaaacacaacagaatcgcaaactcacggatttctaccccgtgcga
aggagctccaggaagagcaaagctgagctgcagtctgaagagaggaaaagaatagatgag
ttgattgaaagcgggaaggaagaaggaatgaagattgacctcatcgatggcaagggcagg
ggcgtgatcgccaccaagcagttctcccggggcgagttcgtggtagaataccacggggac
ctcatcgagatcaccgatgccaagaagcgggaggctttgtacgcacaagacccctccacg
ggctgctacatgtactatttccagtatctcagcaaaacctactgcgtggatgcaactaga
gagacaaatcgcctgggaagactgatcaatcacagtaaatgtgggaactgccaaaccaaa
ctgcacgacattgacggcgtgcctcacctcatcctcatcgcctcccgcgacatcaaggcc
ggggaggagctcctgtatgactatggggaccgcagccgggcttccatcgaagcctatccc
tggctgaagcattaa

DBGET integrated database retrieval system