KEGG   Felis catus (domestic cat): 101086280Help
Entry
101086280         CDS       T02385                                 

Gene name
PYCR2
Definition
(RefSeq) pyrroline-5-carboxylate reductase 2
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00330  Arginine and proline metabolism
fca01100  Metabolic pathways
fca01230  Biosynthesis of amino acids
Module
fca_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    101086280 (PYCR2)
Enzymes [BR:fca01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     101086280 (PYCR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: P5CR_dimer F420_oxidored Rossmann-like NAD_Gly3P_dh_N ApbA
Motif
Other DBs
NCBI-GeneID: 101086280
NCBI-ProteinID: XP_023103373
Ensembl: ENSFCAG00000012541
Position
F1
AA seq 320 aa AA seqDB search
MSVGFIGAGQLACALARGFTAAGILSAHRIIASSPEMDLPTVSSLRKMGVNLTRSNKETV
RHSDVLFLAVKPHIIPFILDEIGADVQARHIVVSCAAGVTISSVEKKLMAFQPAPKVIRC
MTNTPVVVREGATVYATGTHALVEDGQLLEQLMSSVGFCTEVEEDLIDAVTGLSGSGPAY
AFMALDALADGGVKMGLPRRLAVRLGAQALLGAAKMLLASEQHPGQLKDNVCSPGGATIH
ALHFLESGGFRSLLINAVEASCIRTRELQSMADQEKISPAALKKTLLDRVKLESPTVSTL
THSNSGKLLTRNPAPGGKKE
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtgggcttcatcggcgcgggccagctggcctgtgcgctggcgcggggcttcacg
gccgcaggcatcctgtcggcccacaggatcatagccagctccccggaaatggacctgccc
accgtgtcctcgctccggaagatgggtgtgaacctgacccggagcaacaaggagacggtg
aggcacagtgacgtcctgttcctggccgtgaagccgcacatcatccccttcatcctggac
gagatcggggcggacgtgcaggccaggcacatcgtggtctcctgtgctgccggtgtcacc
atcagctctgtggagaagaagctgatggctttccagccggcccccaaggtgatccgctgc
atgaccaacacgcccgtggtggtgcgggagggcgccacggtgtacgccacgggcacccac
gccctggtggaggacgggcagcttctggaacagctcatgagcagcgtgggcttctgcact
gaggtggaggaggacctgatcgacgctgtcaccgggctcagcggcagcgggcctgcctac
gcattcatggccctggacgcgctggctgatggcggggtgaagatgggcctgccccggcgc
ctggccgtccgactgggggcccaggccctgctgggtgccgccaagatgctgctggcctca
gagcagcaccctggccagctcaaggacaacgtgtgctcacccgggggtgccaccatccac
gccctgcacttcttagagagcgggggcttccgctccctgctcatcaacgccgtggaggcc
tcctgtatccgaacacgggagctgcagtccatggccgaccaggagaagatctccccggcc
gcactcaagaagaccctcctggacagagtgaagctggagtcccccacggtgtccacgctg
acccattccaactccgggaagctcctgacgagaaacccggcccccggaggcaagaaggag
tga

KEGG   Felis catus (domestic cat): 101090490Help
Entry
101090490         CDS       T02385                                 

Gene name
PYCR3
Definition
(RefSeq) pyrroline-5-carboxylate reductase 3 isoform X2
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00330  Arginine and proline metabolism
fca01100  Metabolic pathways
fca01230  Biosynthesis of amino acids
Module
fca_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    101090490 (PYCR3)
Enzymes [BR:fca01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     101090490 (PYCR3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: P5CR_dimer F420_oxidored Rossmann-like NAD_Gly3P_dh_N NAD_binding_2 PDH
Motif
Other DBs
NCBI-GeneID: 101090490
NCBI-ProteinID: XP_006943499
Ensembl: ENSFCAG00000001040
UniProt: M3VVW6
Position
F2
AA seq 277 aa AA seqDB search
MAVVAAPGLDQLRVGFVGAGRMAEALAQGFIRAGKVEAQHILASAPSDRNLCHFRALGCQ
TTHSNQEVVQNCWLVFFATKPHVLPAVLAEVAPVVTTEHILVSVAAGISLSTLEELLPPA
TRVLRISPNLPCVVQEGAMVMARGRHTGNSDAELLQTLLEACGQCEEVPEAHVDIHTGLS
GSGVAFVCAFSEALAEGAIKMGMPSGLAHRIAAQTLLGTAKLLLQKGQHPAQLRTDVCTP
GGTTIYGLHALERGGLRAATMSAVEAATCRARELSGK
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atggcggtggtggcggcacccggtctggaccagttacgcgtgggctttgttggcgccggg
cgtatggcagaggccctcgcgcagggcttcattcgagcaggaaaagtcgaagctcaacac
atactagccagcgcaccgagtgacaggaacctctgccacttccgggctctgggctgccag
accacccactccaaccaggaggttgtgcagaactgctggttagtcttctttgccaccaag
ccccatgtcctgccagctgtcctggcagaggtggcccccgtggtaaccactgagcacatc
ttggtgtctgtggccgccgggatctctctgagtaccctggaggagctgttgccaccagcc
acacgggtgctgcggatctcccccaacctgccctgcgtggttcaagagggcgctatggtg
atggcccgcggccgccacactggaaacagcgacgccgagctcctgcagaccctgctggag
gcctgcgggcagtgcgaggaggtgcctgaggcccacgtggacatccacaccggcctcagt
ggcagcggcgtggccttcgtgtgtgccttctccgaggccttggccgaaggtgccatcaag
atgggcatgcccagtggcctggcccaccgcattgctgcccagaccctgctgggcacagcc
aagttgttgctgcagaaggggcagcacccggctcagctgcggacagacgtgtgcacgccg
ggcggcaccaccatctatgggctccatgcgctggagcggggcgggctgcgggcggccacc
atgagcgccgtggaggctgccacctgccgggccagggagctgagcgggaagtag

KEGG   Felis catus (domestic cat): 101090664Help
Entry
101090664         CDS       T02385                                 

Gene name
PYCR1
Definition
(RefSeq) pyrroline-5-carboxylate reductase 1, mitochondrial isoform X1
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00330  Arginine and proline metabolism
fca01100  Metabolic pathways
fca01230  Biosynthesis of amino acids
Module
fca_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    101090664 (PYCR1)
Enzymes [BR:fca01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     101090664 (PYCR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: P5CR_dimer F420_oxidored Rossmann-like NAD_Gly3P_dh_N ApbA
Motif
Other DBs
NCBI-GeneID: 101090664
NCBI-ProteinID: XP_003997326
Ensembl: ENSFCAG00000011659
Position
E1
AA seq 376 aa AA seqDB search
MEGWGGEWAQGQRPSGQAWHCTPNFFLLWILPHLAPQLPLRIRCQLRGLWAGPASSMSVG
FIGAGQLAFALAKGFTAAGILAAHKIMASSPDMDLATVSALRKMGVNLTSHNKETVRHSD
VLFLAVKPHIIPFILDEIGADVEDRHIVVSCAAGVTISSIEKKLTAFRPAPKVIRCMTNT
PVVVREGATVYATGTHAQVEDGRLLEQLMSSVGFCTEVEEDLIDAVTGLSGSGPAYAFTA
LEALADGGVKMGLPRRLAIRLGAQALLGASKMLLDSEKHPGQLKDNVCSPGGATIHALHV
LESGGFRSLLINAVEASCTRTRELQSMADQEKVSPASIKKTILDKVKLESAPGSSLAPSG
HSKLPPHSLAPAGKRN
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggaggggtggggaggggaatgggcgcagggccagcggcccagtggccaagcctggcac
tgcacacctaacttcttcttgctctggatcctgccccatctcgccccgcagctgcccctg
cgtatccggtgccagctgcgagggctgtgggcggggcctgcgtccagcatgagcgtgggc
tttatcggggcgggccagctggccttcgccttggccaagggcttcacagcagcaggcatc
ctggctgcccacaagataatggccagctccccagacatggacctggccacagtttctgcc
ctcaggaagatgggcgtgaacctgacgtcccacaacaaggagaccgtgaggcacagtgac
gtgctcttcctggccgtgaagccgcacatcatccccttcatcctggacgagattggcgcc
gacgttgaagatcggcacatcgtggtgtcgtgcgcggctggtgtcaccatcagctccatc
gagaagaagctgacggcgttccggccagcccctaaagtcatccgctgcatgaccaataca
cctgtcgtggtgcgggagggggccaccgtgtacgccacgggcacccacgcccaggtggaa
gacggcaggctcctggagcagctcatgagtagtgtgggcttctgcaccgaggtggaggag
gacctaatcgatgctgtcacggggctcagtggcagcggcccagcctatgcgttcacagcc
ctggaggccctggccgacggcggcgtgaagatggggcttccgcggcgcctggccatccgc
ctcggggcccaggctctgctgggagcctccaagatgctcctggactcggaaaagcaccct
ggccagctcaaggacaacgtctgctctcccggtggggccaccatccatgccctgcacgtg
ctggagagcgggggtttccgttcgctcctcatcaatgccgtggaggcctcctgcacccgc
acacgggagctgcagtccatggctgaccaggagaaggtctcaccggcctccatcaagaag
accatcttggacaaggtgaagctggagtctgctccagggtcctcgctggccccttccggc
cactccaagctgccgccccacagcctggccccggcaggcaagaggaactga

DBGET integrated database retrieval system