KEGG   Felis catus (domestic cat): 101086401Help
Entry
101086401         CDS       T02385                                 

Gene name
ASPG
Definition
(RefSeq) 60 kDa lysophospholipase isoform X2
  KO
K13278  60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
fca  Felis catus (domestic cat)
Brite
Enzymes [BR:fca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     101086401 (ASPG)
    3.1.1.47  1-alkyl-2-acetylglycerophosphocholine esterase
     101086401 (ASPG)
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.1  asparaginase
     101086401 (ASPG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Asparaginase Ank_2 Ank_5 Ank_4 Ank Ank_3
Motif
Other DBs
NCBI-GeneID: 101086401
NCBI-ProteinID: XP_019689264
Ensembl: ENSFCAG00000024828
Position
B3
AA seq 562 aa AA seqDB search
MSRAVEPERRLLAIYTGGTIGMRIERGVLVPGRGLAAALRTLPMFHDEDHARALGLPEDT
LVLPPASPDQRVIYTVLECQPLFDSSDMTITEWVQIAQTIERHYGQYHGFVVVHGTDTMA
FAASVLSFVLENLQKTVILTGAQVPIHALWNDGRENLLGALLMAGQYVIPENQLFRGNRV
TKVDSRRFAAFCSPNLPPLAVVGADVILNRELVRKVRGKERLVVHSSVERDVGLLRLYPG
IPAALVRAFLQPPLRGVVMETFGCGNGPTKPDLLREFRAATERGLLIVNCTHCLQGTVTS
GYAAGMAVAGAGIVSGFDMTSEAAMAKLSYVLGQPGLSLDSRKQLLARDLRGEVTLPAGD
EHQPSLTCSTLGRGVAQLLSLSQEADAVREALTPGLACAAAHAGDLDVLQALVELGSDLS
QENFNGQTPLHAAARGGHPEVVTMLLQRGVGVSARDEDGLSPLLLAVKGRHQDIIGLLRA
AGACLSPQELEDAGTELCRLASRADLEGLQSWWRAGADLACPGYDGRSALLVAEAAGNLE
VVTFLQNLQGGAAVQAPGPATL
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgcgcggtggagcctgagcggaggctcctggccatctacaccggcggcactatc
ggcatgcggatcgagcgcggcgtgctcgtccctgggaggggcctggccgctgccttgagg
acgctgcccatgttccatgatgaggaccacgcccgggcccttggcctcccggaggacacc
ctggtgctgccgcccgccagccctgaccagagggtcatctacacggtactggagtgccag
cccctcttcgactccagtgacatgactatcaccgagtgggttcagattgcccagaccatc
gagagacactacgggcagtaccacgggttcgtggtcgtccacggcactgacaccatggcc
ttcgcggcctccgtgctgtccttcgtgctggagaacctgcagaaaaccgtcatcctgact
ggtgcccaggtgcccatccacgccctatggaatgatggccgtgagaacctgctgggggcc
ctgctcatggccggccagtacgtgatccccgagaatcagctgtttcggggcaaccgagtg
accaaggtggactcgcgcaggtttgcggccttctgctcccccaacctgccccctctggcc
gtcgtgggcgctgacgtcatactcaaccgggagctggtgcggaaggtccgagggaaggag
cggctggtggtgcacagcagcgtggagcgtgacgtggggctgctgcgtctctaccccggg
atccccgctgccctggttcgggccttcctgcagccccccctgaggggcgtcgtcatggag
acgttcggctgcgggaacgggcccaccaagccggacctgctgcgggagttccgggccgcc
accgagcgagggctcctcatcgtcaactgcacacactgccttcagggcaccgtgacctct
ggctacgcagccggcatggccgtggcgggagccggcatcgtctccggctttgacatgacg
tcggaagctgccatggccaagctgtcctacgtgctgggccagccggggctgagcctggac
agcaggaaacagctgctggccagggacctccggggggaggtgacgctgcccgcgggggac
gagcaccagccctcgctgacttgtagcacgctgggccggggggtcgcccagctcctcagt
ctgagccaggaggccgatgcggtgcgggaagctctgacgcctggcctggcctgtgctgcg
gcccatgcgggcgacctggacgtgctgcaggcacttgtggagctgggcagtgacctgagc
caagagaactttaacggtcagacccctctgcacgcagctgcccggggaggccaccccgag
gtggtcaccatgctgctgcagagaggggtgggtgtgagcgcccgggatgaggatggactg
agcccgctgctcctggcggtgaagggcaggcatcaggatatcattgggctactgcgggct
gctggggcctgcctgtccccccaggagctagaggacgcagggaccgagctgtgcaggctg
gcttccagggcggacctcgaaggcctgcagtcatggtggcgggcgggggctgacctggct
tgcccaggctatgacgggcgcagtgccctgcttgttgcagaagcagctggaaacctggaa
gtggtgacctttctgcagaacctccagggtggggctgctgtccaggccccaggcccagcc
actctgtga

DBGET integrated database retrieval system