KEGG   Felis catus (domestic cat): 101086509Help
Entry
101086509         CDS       T02385                                 

Gene name
GADD45G
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 gamma
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04068  FoxO signaling pathway
fca04110  Cell cycle
fca04115  p53 signaling pathway
fca04210  Apoptosis
fca04218  Cellular senescence
fca05169  Epstein-Barr virus infection
fca05200  Pathways in cancer
fca05202  Transcriptional misregulation in cancer
fca05210  Colorectal cancer
fca05212  Pancreatic cancer
fca05213  Endometrial cancer
fca05214  Glioma
fca05216  Thyroid cancer
fca05217  Basal cell carcinoma
fca05218  Melanoma
fca05220  Chronic myeloid leukemia
fca05222  Small cell lung cancer
fca05223  Non-small cell lung cancer
fca05224  Breast cancer
fca05225  Hepatocellular carcinoma
fca05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101086509 (GADD45G)
   04068 FoxO signaling pathway
    101086509 (GADD45G)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101086509 (GADD45G)
   04210 Apoptosis
    101086509 (GADD45G)
   04115 p53 signaling pathway
    101086509 (GADD45G)
   04218 Cellular senescence
    101086509 (GADD45G)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101086509 (GADD45G)
   05202 Transcriptional misregulation in cancer
    101086509 (GADD45G)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101086509 (GADD45G)
   05212 Pancreatic cancer
    101086509 (GADD45G)
   05225 Hepatocellular carcinoma
    101086509 (GADD45G)
   05226 Gastric cancer
    101086509 (GADD45G)
   05214 Glioma
    101086509 (GADD45G)
   05216 Thyroid cancer
    101086509 (GADD45G)
   05220 Chronic myeloid leukemia
    101086509 (GADD45G)
   05217 Basal cell carcinoma
    101086509 (GADD45G)
   05218 Melanoma
    101086509 (GADD45G)
   05213 Endometrial cancer
    101086509 (GADD45G)
   05224 Breast cancer
    101086509 (GADD45G)
   05222 Small cell lung cancer
    101086509 (GADD45G)
   05223 Non-small cell lung cancer
    101086509 (GADD45G)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    101086509 (GADD45G)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:fca03036]
    101086509 (GADD45G)
Chromosome and associated proteins [BR:fca03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     101086509 (GADD45G)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     101086509 (GADD45G)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L7Ae
Motif
Other DBs
NCBI-GeneID: 101086509
NCBI-ProteinID: XP_023099007
Ensembl: ENSFCAG00000022749
Position
D4
AA seq 159 aa AA seqDB search
MTLEEIRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFC
VLAADEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGDEEAASGDLHCI
LISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgactctggaggaaatccgcggccaagacacggttcccgaaagcaccgccaggatgcag
ggcgccgggaaagcgctgcacgagctgctgctgtcggcacagcgccagggctgtcttacc
gccggcgtctatgagtccgccaaagtcctgaacgtggaccccgacaacgtgaccttctgc
gtgctggccgccgacgaggaggacgagggcgacatcgcgctgcagatccactttacgctg
atccaggcgttctgctgcgagaacgacatcgacatcgtgcgcgtgggcgacgtacagcgg
ctggcggcgatcgtgggcgcgggcgacgaggaggccgcgtcgggagacctacactgcatc
ctcatttcgaaccccaatgaggacgcgtggaaggaccccgccttggagaagctcagcctg
ttctgcgaggagagccgcagtgtcaacgactgggtgcccagtatcaccctccccgagtga

KEGG   Felis catus (domestic cat): 101087971Help
Entry
101087971         CDS       T02385                                 

Gene name
GADD45B
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 beta
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04068  FoxO signaling pathway
fca04110  Cell cycle
fca04115  p53 signaling pathway
fca04210  Apoptosis
fca04218  Cellular senescence
fca05169  Epstein-Barr virus infection
fca05200  Pathways in cancer
fca05202  Transcriptional misregulation in cancer
fca05210  Colorectal cancer
fca05212  Pancreatic cancer
fca05213  Endometrial cancer
fca05214  Glioma
fca05216  Thyroid cancer
fca05217  Basal cell carcinoma
fca05218  Melanoma
fca05220  Chronic myeloid leukemia
fca05222  Small cell lung cancer
fca05223  Non-small cell lung cancer
fca05224  Breast cancer
fca05225  Hepatocellular carcinoma
fca05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101087971 (GADD45B)
   04068 FoxO signaling pathway
    101087971 (GADD45B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101087971 (GADD45B)
   04210 Apoptosis
    101087971 (GADD45B)
   04115 p53 signaling pathway
    101087971 (GADD45B)
   04218 Cellular senescence
    101087971 (GADD45B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101087971 (GADD45B)
   05202 Transcriptional misregulation in cancer
    101087971 (GADD45B)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101087971 (GADD45B)
   05212 Pancreatic cancer
    101087971 (GADD45B)
   05225 Hepatocellular carcinoma
    101087971 (GADD45B)
   05226 Gastric cancer
    101087971 (GADD45B)
   05214 Glioma
    101087971 (GADD45B)
   05216 Thyroid cancer
    101087971 (GADD45B)
   05220 Chronic myeloid leukemia
    101087971 (GADD45B)
   05217 Basal cell carcinoma
    101087971 (GADD45B)
   05218 Melanoma
    101087971 (GADD45B)
   05213 Endometrial cancer
    101087971 (GADD45B)
   05224 Breast cancer
    101087971 (GADD45B)
   05222 Small cell lung cancer
    101087971 (GADD45B)
   05223 Non-small cell lung cancer
    101087971 (GADD45B)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    101087971 (GADD45B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:fca03036]
    101087971 (GADD45B)
Chromosome and associated proteins [BR:fca03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     101087971 (GADD45B)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     101087971 (GADD45B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L7Ae
Motif
Other DBs
NCBI-GeneID: 101087971
NCBI-ProteinID: XP_003981665
Ensembl: ENSFCAG00000013046
Position
A2
AA seq 160 aa AA seqDB search
MTLEELVACDNAAQKMQTVSAAVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLA
IDEEEEDDIALQIHFTLIQSFCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCL
LVTNPHTDAWKSHGLVEVASYCEESRGNNQWVPYISLQER
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgacgctggaagagctcgtggcatgcgacaacgcggcgcagaagatgcagaccgtgagc
gccgcggtggaggagctgctggtggccgcgcagcgccaggaccgcctcaccgtgggggtg
tacgagtcagccaagttgatgaatgtggaccctgacagcgtggtcctgtgccttctggcc
atcgatgaggaggaggaggatgacatcgccctgcagatacacttcacgctcatccagtcc
ttttgctgcgacaacgacatcaatatcgtccgggtgtcaggcatgcagcgcctggcacag
ctgctgggcgagcccgcggagacccagggcaccaccgaggcccgagacctgcactgcctc
ctggtcacgaatcctcacacagatgcctggaaaagccacggcctggtcgaggtagccagt
tactgtgaagagagccgaggaaacaaccagtgggtcccctacatctccctccaggagcgt
tga

DBGET integrated database retrieval system