KEGG   Felis catus (domestic cat): 101086519Help
Entry
101086519         CDS       T02385                                 

Gene name
POLD1
Definition
(RefSeq) DNA polymerase delta catalytic subunit
  KO
K02327  DNA polymerase delta subunit 1 [EC:2.7.7.7]
Organism
fca  Felis catus (domestic cat)
Pathway
fca03030  DNA replication
fca03410  Base excision repair
fca03420  Nucleotide excision repair
fca03430  Mismatch repair
fca03440  Homologous recombination
Module
fca_M00262  DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    101086519 (POLD1)
   03410 Base excision repair
    101086519 (POLD1)
   03420 Nucleotide excision repair
    101086519 (POLD1)
   03430 Mismatch repair
    101086519 (POLD1)
   03440 Homologous recombination
    101086519 (POLD1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:fca03032]
    101086519 (POLD1)
   03400 DNA repair and recombination proteins [BR:fca03400]
    101086519 (POLD1)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     101086519 (POLD1)
DNA replication proteins [BR:fca03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    101086519 (POLD1)
DNA repair and recombination proteins [BR:fca03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      101086519 (POLD1)
   MMR (mismatch excision repair)
    DNA polymerase delta complex
     101086519 (POLD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_pol_B DNA_pol_B_exo1 zf-C4pol DNA_pol_B_2 DNA_pol_B_exo2
Motif
Other DBs
NCBI-GeneID: 101086519
NCBI-ProteinID: XP_023100905
Position
E2
AA seq 1107 aa AA seqDB search
MDGKRRPGPGPGVPPKRARGGLWDEDEPSQPSQFEEELALMEEMEAEHRLQEQEEELLQP
ALEGAADGQFSPTAIDARWLRPSPPSLDPQTEPLIFQQLEIDHYVGLAQPLPGAAPPPPG
SVPVLRAFGVTDEGVSVCCHIHGFAPYFYTPAPPGFGREHLGDLQRELNAAISRDQRGGK
ELAGPAVLSVELCSRESMFGYHGHGPSPFLRITLALPRLLAPARRLLEQGIRVPGLGTPS
FAPYETNVDFEIRFMVDTDIVGCNWLELPAGKYLLRLEGKATHCQLEADVQWSDVVSHPP
EGEWQRIAPLRVLSFDIECAGRKGIFPEPERDPVIQICSLGLRWGEPEPFLRLALTLRPC
APILGAKVQSYEREEELLQAWSTFIRIMDPDVITGYNIQNFDLPYLISRAQTLKVESFPF
LGRVSGLRSTIRDSSFQSKQTGRRDSKVVSMVGRVQMDMLQVLLREYKLRSYTLNAVSFH
FLGEQKEDVQHSIITDLQNGNDQTRRRLAVYCLKDAFLPLRLLERLMVLVNAMEMARVTG
VPLGYLLTRGQQVKVVSQLLRQAMREGLLMPVVKTEGVEDYTGATVIEPLKGYYDVPIAT
LDFSSLYPSIMMAHNLCYTTLLRPGAAQKLGLTEDQFIKTPTGDEFVKTSVRKGLLPQIL
ENLLSARKRAKAELAKETDPLRRQVLDGRQLALKVSANSVYGFTGAQVGKLPCLEISQSV
TGFGRQMIEKTKQLVESKYTVENGYGTSAKVVYGDTDSVMCRFGVSSVAEAMALGREAAD
WVSGHFPPPIRLEFEKVYFPYLLISKKRYAGLLFSSRPDAHDRMDCKGLEAVRRDNCPLV
ANLVTASLRRLLIDRDPAGAVAHAQDVISDLLCNRIDISQLVITKELTRAASDYAGKQAH
VELAERMRKRDPGSAPSLGDRVPYVIIGAAKGVAAYMKSEDPLFVLEHSLPIDTQYYLEQ
QLAKPLLRIFEPILGEGRAEAVLLRGDHTRCKTVLTGKVGGLLAFAKRHSCCIGCRTVLG
HQGAVCKFCQPRESELYQKEVSHLNALEERFSRLWTQCQRCQGSLHEDVICTSRDCPIFY
MRKKVRKDLEDQEQLLRRFGPPGPEAW
NT seq 3324 nt NT seq  +upstreamnt  +downstreamnt
atggatggcaagcggcggccgggcccgggccctggggtgccccccaagcgggcccgtggg
ggcctctgggatgaggatgagccgtctcagccatcccagttcgaggaggagctggcgctg
atggaggagatggaggcagagcacaggctgcaggaacaggaggaggagttgctgcagccg
gccctggagggagccgcggacgggcagttctccccaacggccatagatgcccgctggctt
cgcccctccccgccctccctggatccccagacggagcccctcatcttccagcagttggag
atcgaccattacgtgggcctggcgcagcccctgcctggagcagccccgccaccccccggc
tccgtccctgtcctccgtgccttcggagtcactgatgagggcgtgtccgtctgctgccac
atccacggctttgctccctacttctacaccccggcgccccctggttttgggcgcgagcac
ctgggcgacctgcagcgggagctgaatgccgccatcagcagggaccagcgcggagggaag
gagctcgcggggccggccgtgctatctgtggagctgtgctcccgggagagcatgttcggg
taccatgggcacggcccctccccgtttctgcgcatcaccctggcgctgccgcgcctcctg
gcccccgcccgccgcctcctggagcagggcatccgtgtgccgggcctgggcacccccagc
ttcgcgccctacgagaccaatgtggactttgagatccggttcatggtggacacagacatc
gtaggctgcaactggttggaactcccagcggggaaatacctcctgaggctggaggggaag
gccacgcattgtcagctggaggcggacgtgcagtggtctgacgtggtcagtcacccgcca
gaaggggagtggcagcgaattgcgcccctgcgcgtgctcagctttgacatcgagtgtgct
ggccgcaaaggcattttcccggagcctgagcgggaccccgtgatccagatctgctccctg
ggcctgcgctggggtgagccggagcccttcctgcgcctggcgctcaccctgcggccctgc
gcccctatcctgggcgccaaagtgcagagctacgagcgggaggaggagctgttgcaggcg
tggtcgaccttcattcgcatcatggaccccgatgtgatcaccggctacaacatccagaac
tttgaccttccgtacctcatctcccgggcccagaccctcaaggtggagtcgttccccttc
ctgggccgcgtgtctggcctccgctccaccatccgggactcgtccttccagtccaagcag
accggccggcgggacagcaaggtggtcagcatggtgggccgcgtgcagatggacatgctg
caggtgttactgcgagagtataagctccgctcctacacgctcaacgccgtgagcttccac
ttcctgggcgagcagaaagaggacgtccagcacagcatcatcactgacctgcagaacggg
aacgaccagacacgccgccgcctggccgtgtactgcctcaaggacgccttcctgcccctg
cggctgctggagcggctcatggtgctggtgaacgccatggagatggcgcgcgtcaccggc
gtgccccttggctatctgctcacccgcggccagcaggtcaaggtcgtgtcccagctgctg
cggcaggccatgcgcgaggggctgctgatgcctgtggtaaagacagaaggtgtcgaggac
tacacgggagccacagtcatcgagcccctcaaagggtactacgatgtccccatcgccaca
ctagacttctcctctctgtacccgtccatcatgatggcccacaacctgtgctacaccaca
ctgctgcggcccggggccgcccagaaactgggcctgacagaggatcagttcatcaagacg
cccacaggggatgagtttgtgaagacgtcagtgcggaagggcctcctgccccagatcctg
gagaaccttctcagcgcccggaagagggccaaggctgagctggccaaagagacagacccc
ctgcgtcggcaggtgttggatgggcggcagctggcgctcaaagtgagcgccaactctgta
tacggcttcactggtgcccaggtgggcaagctgccgtgcctggagatctcacagagcgtt
accggctttgggcgccagatgattgagaaaacaaagcagttggtggagtccaagtacacg
gtggagaatggctatggcaccagtgccaaggtggtgtatggtgacactgactcagtcatg
tgccgatttggtgtctcttctgtggccgaggcaatggccctggggcgggaggctgcggac
tgggtgtcaggccacttccccccgcctatccggctcgagtttgaaaaggtctactttccc
tacctgctcatcagcaagaagcggtacgctggcctgcttttctcctcccggccggacgct
cacgaccgcatggactgcaagggtctggaggctgtgcgtcgggacaactgccccctcgtg
gccaacctcgtcaccgcctccctgcgccgcctgctcatcgaccgagaccccgcgggtgcc
gtggcccacgcacaggacgtcatctcagacctgctgtgtaaccgcattgacatctcccag
ctcgtcatcaccaaggagctgacccgcgcggcctctgactacgccggcaagcaggcccac
gtggaactggccgagaggatgaggaagcgggaccccgggagcgcgcccagcttgggcgac
cgtgtcccctacgtgatcatcggcgctgccaagggcgtggctgcctacatgaagtccgag
gaccccctctttgtgctggagcacagcctgcccatcgacacgcagtactacctggaacag
cagctcgccaagcccctcctgcgcatcttcgagcccatcctgggcgagggccgcgctgag
gctgtgctgctgaggggtgaccacacgcgctgcaagacggtgctcacgggcaaggtgggc
ggccttctggcctttgccaaacgccacagctgctgcatcggctgccgcactgtcctcggt
caccagggggccgtgtgcaagttctgccagcctcgggagtcggagctgtatcagaaggag
gtgtcgcacctgaatgccctggaggagcgcttctcgcgcctgtggacacagtgccagcgc
tgtcagggcagcctgcatgaggatgtcatctgcaccagccgggactgccccatcttctac
atgcgcaagaaggtgcgcaaggacctggaggaccaggagcagcttctgagacgctttggc
cctcctggccctgaggcttggtga

KEGG   Felis catus (domestic cat): 101091308Help
Entry
101091308         CDS       T02385                                 

Gene name
POLD4
Definition
(RefSeq) DNA polymerase delta subunit 4
  KO
K03505  DNA polymerase delta subunit 4
Organism
fca  Felis catus (domestic cat)
Pathway
fca03030  DNA replication
fca03410  Base excision repair
fca03420  Nucleotide excision repair
fca03430  Mismatch repair
fca03440  Homologous recombination
Module
fca_M00262  DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    101091308 (POLD4)
   03410 Base excision repair
    101091308 (POLD4)
   03420 Nucleotide excision repair
    101091308 (POLD4)
   03430 Mismatch repair
    101091308 (POLD4)
   03440 Homologous recombination
    101091308 (POLD4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:fca03032]
    101091308 (POLD4)
   03400 DNA repair and recombination proteins [BR:fca03400]
    101091308 (POLD4)
DNA replication proteins [BR:fca03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    101091308 (POLD4)
DNA repair and recombination proteins [BR:fca03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      101091308 (POLD4)
   MMR (mismatch excision repair)
    DNA polymerase delta complex
     101091308 (POLD4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_pol_delta_4
Motif
Other DBs
NCBI-GeneID: 101091308
NCBI-ProteinID: XP_003993745
UniProt: M3WUS6
Position
D1
AA seq 107 aa AA seqDB search
MGRKRLITDSYPVVKRREGPAGHSKGELAPELGEEPQPLSVDEAELELLRQFDLAWQYGP
CTGITRLQRWHRAEQMGLEPPAEVRQVLQTHPGDPRFQYSLWHVYPL
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atgggccggaagcggctcatcactgactcctaccctgtagtgaagaggagggagggcccc
gctgggcacagcaagggggagctggcgccagagctaggggaagagccccagcctctgagc
gtggatgaagcagagctggagctgctgaggcagtttgatctggcctggcaatatgggccc
tgcacagggatcacgcggctgcagcgctggcatcgggccgagcagatgggcttggagccc
cccgctgaagtgcgccaggtgctgcagacccaccctggagatccccgcttccagtacagc
ctctggcacgtctatcccctttga

KEGG   Felis catus (domestic cat): 101093711Help
Entry
101093711         CDS       T02385                                 

Gene name
POLD3
Definition
(RefSeq) DNA polymerase delta subunit 3 isoform X1
  KO
K03504  DNA polymerase delta subunit 3
Organism
fca  Felis catus (domestic cat)
Pathway
fca03030  DNA replication
fca03410  Base excision repair
fca03420  Nucleotide excision repair
fca03430  Mismatch repair
fca03440  Homologous recombination
Module
fca_M00262  DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    101093711 (POLD3)
   03410 Base excision repair
    101093711 (POLD3)
   03420 Nucleotide excision repair
    101093711 (POLD3)
   03430 Mismatch repair
    101093711 (POLD3)
   03440 Homologous recombination
    101093711 (POLD3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:fca01009]
    101093711 (POLD3)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:fca03032]
    101093711 (POLD3)
   03400 DNA repair and recombination proteins [BR:fca03400]
    101093711 (POLD3)
Protein phosphatases and associated proteins [BR:fca01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101093711 (POLD3)
DNA replication proteins [BR:fca03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    101093711 (POLD3)
DNA repair and recombination proteins [BR:fca03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      101093711 (POLD3)
   MMR (mismatch excision repair)
    DNA polymerase delta complex
     101093711 (POLD3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CDC27
Motif
Other DBs
NCBI-GeneID: 101093711
NCBI-ProteinID: XP_006937001
Ensembl: ENSFCAG00000008169
UniProt: M3W935
Position
D1
AA seq 461 aa AA seqDB search
MADQLYLENIDEFVTDQNKIVTYKWLSYTLGVHVNQAKQMLYDYVERKRKENSGAQLHVT
YLVSGSLIQNGHSCHKVAVVREDKLEAVKSKLAVTASIHVYSIQKAMLKDSGPLFNTDYD
ILKSNLQNCSKFSAIQCAAAVPRAPAESSSSEKFEQSDLQVSSETQANNELTTNGHSPPT
SKQILQQPKGIMGMFASKAASKTQEANKETKTEAKEVSSAGNKAPGKGNVMNNFFGKAAM
NKLKVNLDSEQAVKEEKIVEQPPVSVTEPKLAAPTGLKKPSKKAEPVKMQQKEKKRGKRM
ELSDDETKETESMKKKRRRIKLPESDSSEDEVIPDSPGDYEAESPSPPPPASPPPEPVPK
TEPEPPSVKSSNGEKRKRKRVLKSKTFVDEEGCIVTEKVYVSESCTDSEEELKMKTSSVH
RPSAMTVKKEPKEERKGPKKGTAALGKANRQVSITGFFQRK
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggcggaccagctttatctggaaaatatagacgagttcgtcacggaccagaacaagatc
gtgacatacaaatggctgagctatacactaggagttcatgttaaccaggctaaacagatg
ctgtatgattatgttgaaaggaagcgaaaggagaattcaggagcccagctgcatgtcacc
tatttagtgtctggcagtctcattcagaatggacattcttgccacaaggttgcagtagtg
agagaagataaattggaagcagtgaagtccaagctagctgtgactgccagcatccatgtg
tacagcatccagaaagccatgctaaaggacagtgggcctctgttcaataccgactatgac
atccttaaaagcaacttgcagaactgcagcaagtttagtgccatacaatgtgcagctgca
gttcccagagctcctgctgaatcctcatcttccgaaaagtttgagcagtcagatcttcaa
gtatcgagtgagacacaagccaataatgagttgacaaccaatggtcatagtccacctacc
tccaaacagattttacagcagcccaagggaataatgggaatgtttgcctctaaagctgct
tctaaaacccaagaagccaacaaggaaaccaaaacagaggctaaagaggtatcttctgca
ggcaacaaggcaccagggaaagggaatgtgatgaacaatttttttggaaaagctgctatg
aataaacttaaagtcaatttggattcagaacaagcagtgaaagaagaaaaaatagtggag
caacctccagtgtctgtcactgaaccaaagctggcagcccctacaggcctgaagaaaccc
agcaaaaaagcagagcctgttaagatgcagcagaaggaaaaaaaaagggggaagcgaatg
gagttatctgatgatgagacaaaagaaactgaaagtatgaagaaaaagaggagaagaatc
aaacttcctgagtctgatagcagtgaagatgaagtcataccagactctcctggggattat
gaagctgagtcaccatccccacctcctcctgcttctccacctcctgaaccagtgcctaag
actgaaccagagcctccttctgtcaagagctcaaatggagaaaaaagaaaacgaaaacgg
gtgctgaagtctaagacctttgtggatgaggaaggctgcatagtgactgaaaaagtctat
gtgagtgaatcctgcacagatagtgaagaggagcttaagatgaagacctcctcggtacat
agaccctccgccatgacggtgaaaaaagaacccaaagaagaacgaaagggcccaaagaaa
gggactgctgctctgggcaaagccaacagacaagtatccattactggcttcttccagagg
aagtga

KEGG   Felis catus (domestic cat): 101095089Help
Entry
101095089         CDS       T02385                                 

Gene name
POLD2
Definition
(RefSeq) DNA polymerase delta subunit 2
  KO
K02328  DNA polymerase delta subunit 2
Organism
fca  Felis catus (domestic cat)
Pathway
fca03030  DNA replication
fca03410  Base excision repair
fca03420  Nucleotide excision repair
fca03430  Mismatch repair
fca03440  Homologous recombination
Module
fca_M00262  DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    101095089 (POLD2)
   03410 Base excision repair
    101095089 (POLD2)
   03420 Nucleotide excision repair
    101095089 (POLD2)
   03430 Mismatch repair
    101095089 (POLD2)
   03440 Homologous recombination
    101095089 (POLD2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:fca03032]
    101095089 (POLD2)
   03400 DNA repair and recombination proteins [BR:fca03400]
    101095089 (POLD2)
DNA replication proteins [BR:fca03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    101095089 (POLD2)
DNA repair and recombination proteins [BR:fca03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      101095089 (POLD2)
   MMR (mismatch excision repair)
    DNA polymerase delta complex
     101095089 (POLD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_pol_E_B DNA_pol_D_N
Motif
Other DBs
NCBI-GeneID: 101095089
NCBI-ProteinID: XP_003982626
Ensembl: ENSFCAG00000014359
UniProt: M3WKK1
Position
A2
AA seq 469 aa AA seqDB search
MFSEQAAQRAHTLLSPPSASNATFARVPVSMYTNSSQPFRLGERSFSRQYAHIYATRLIQ
MRPFLVSRAKQHWGAGVQIKKLCELQPGEKCCVVGTLFKAMPLQPSILREISEEHNLLPQ
PPRSKYIHPDDELVLEDELQRIKLEGTIDVCKLVTGTVLAVLGSVRDTGKFLVEDHCFAE
LAPQEPAPCLDTDRFVLLVSGLGLGGGGGESLLGTQLLVDVVTGQLGDEGEQCSAAHVSR
VILAGNLLSHNTQSRDSINKAKYLTKKTQAASVEAVKMLDEILLQLSASVPVDVMPGEFD
PTNYTLPQQPLHPCMFPLATAYSTLQLVTNPYQATIDGVRFLGTSGQNVSDIFRYSSMED
HLEILEWTLRIRHISPTAPDTLGCYPFYKTDPFIFPECPHVYFCGNTPSFGSKIFRGPED
QRVLLVAVPDFSSTQTACLVNLRSLACQPISFSGFGAEEEDLGGLGLDP
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgttctctgagcaggctgcccagagggcccatactctgctctccccgccgtcagccagc
aatgccacctttgcccgcgtgcctgtgtccatgtacaccaactcctcgcagcccttccgg
ctgggggagcgcagcttcagccggcagtatgcccacatttatgccacccgcctcatccaa
atgaggcccttcctggtgagccgggccaaacagcactggggtgctggagtccaaataaag
aagctatgtgagctacagcccggggagaagtgctgtgtggtggggaccctgttcaaggcc
atgccgctccagccatccatcctgcgggagatcagcgaagagcacaacctactcccccag
cccccacggagcaaatacatccatccggacgacgagctggtcttggaagatgaactgcag
cgcatcaaactggaaggcaccattgatgtgtgcaagctggtcacagggacggtcctggcc
gtgctcggctccgtgagagacactgggaagtttctggtggaggaccactgctttgcagag
cttgctcctcaggagcctgcaccctgccttgacacagacaggtttgtgctgctggtgtct
ggcctgggcctgggtggaggtgggggcgagagcctgctgggcacccagctgctggtggat
gtggtgaccgggcagctgggggacgagggggagcagtgcagtgccgcgcacgtgtcccgg
gtaatcctggccgggaacctcctgagccacaacacccagagcagagactccatcaacaag
gccaagtacttaaccaagaaaacccaggcagccagcgtggaggccgtcaagatgctggat
gagatcctcctgcagctgagtgcctcggtacccgtggatgtgatgccgggagaatttgac
ccaaccaactacacactcccccagcagcccctgcacccctgcatgttcccgttggccact
gcctactcaaccctccagctggtcaccaacccctaccaggccaccattgatggagtcaga
ttcctagggacatcaggacagaatgtgagcgacattttccggtacagcagcatggaggac
cacctggagatactggagtggacgctgcgcatccgtcacatcagccccacagcccccgac
acgctaggttgctaccccttctacaagacagacccgttcatctttcccgagtgtcctcat
gtctacttttgtgggaacacccccagctttggctctaaaatcttccgaggcccagaggac
cagagggtgctgctggtggctgtccctgacttcagcagcacgcagaccgcctgtctcgtg
aatctgcgcagcctggcctgccagcccatcagcttctcaggcttcggagctgaggaggag
gacctggggggcctgggtctggacccctga

DBGET integrated database retrieval system