KEGG   Felis catus (domestic cat): 101086541Help
Entry
101086541         CDS       T02385                                 

Gene name
GNA11
Definition
(RefSeq) guanine nucleotide-binding protein subunit alpha-11
  KO
K04635  guanine nucleotide-binding protein subunit alpha-11
Organism
fca  Felis catus (domestic cat)
Pathway
fca04020  Calcium signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04270  Vascular smooth muscle contraction
fca04540  Gap junction
fca04725  Cholinergic synapse
fca04730  Long-term depression
fca04911  Insulin secretion
fca04912  GnRH signaling pathway
fca04925  Aldosterone synthesis and secretion
fca04927  Cortisol synthesis and secretion
fca04928  Parathyroid hormone synthesis, secretion and action
fca04934  Cushing syndrome
fca05142  Chagas disease (American trypanosomiasis)
fca05146  Amoebiasis
fca05163  Human cytomegalovirus infection
fca05170  Human immunodeficiency virus 1 infection
fca05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    101086541 (GNA11)
   04022 cGMP-PKG signaling pathway
    101086541 (GNA11)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101086541 (GNA11)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101086541 (GNA11)
   04912 GnRH signaling pathway
    101086541 (GNA11)
   04928 Parathyroid hormone synthesis, secretion and action
    101086541 (GNA11)
   04925 Aldosterone synthesis and secretion
    101086541 (GNA11)
   04927 Cortisol synthesis and secretion
    101086541 (GNA11)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101086541 (GNA11)
  09156 Nervous system
   04725 Cholinergic synapse
    101086541 (GNA11)
   04730 Long-term depression
    101086541 (GNA11)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101086541 (GNA11)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101086541 (GNA11)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101086541 (GNA11)
   05163 Human cytomegalovirus infection
    101086541 (GNA11)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101086541 (GNA11)
   05142 Chagas disease (American trypanosomiasis)
    101086541 (GNA11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101086541 (GNA11)
   04031 GTP-binding proteins [BR:fca04031]
    101086541 (GNA11)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101086541 (GNA11)
  Exosomal proteins of melanoma cells
   101086541 (GNA11)
GTP-binding proteins [BR:fca04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 3 (Gq/11) [OT]
    101086541 (GNA11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-alpha Arf Gtr1_RagA MMR_HSR1
Motif
Other DBs
NCBI-GeneID: 101086541
NCBI-ProteinID: XP_023099389
Position
A2
AA seq 359 aa AA seqDB search
MTLESMMACCLSDEVKESKRINAEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMR
IIHGAGYSEEDKRGFTKLVYQNIFTAMQAMIRAMETLKILYKYEQNKANALLIREVDVEK
VTTFEHRYVHAIKTLWDDPGIQECYDRRREYQLSDSAKYYLADVDRIATSGYLPTQQDVL
RVRVPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLV
ESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEDKILHSHLVDYFPEFDGPQR
DAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgactctggagtccatgatggcgtgttgcctgagcgatgaggtgaaggagtccaagcgg
atcaacgccgagatcgagaagcagctgcggcgggacaagcgcgacgcccggcgcgagctc
aagctgctgctgctcggcacgggcgagagcgggaagagcacgttcatcaagcagatgcgc
atcatccacggggcgggctactcggaggaggacaagcggggcttcaccaagctcgtgtat
cagaacatcttcaccgccatgcaggccatgatccgcgccatggagaccctgaagatcctg
tacaagtacgagcagaacaaggccaacgcgctcctgatccgtgaggtcgatgtggagaag
gtgacgacgttcgagcaccggtatgtccacgccatcaagaccctgtgggacgaccctggc
atccaggagtgctacgaccggaggcgcgagtatcagctctcggactccgccaagtactac
ctggccgacgtggaccgcatcgccacctcgggctacctgcccacccagcaggacgtgctg
cgggtccgagtgcccaccaccggcatcatcgagtaccctttcgacctggagaacatcatc
ttcaggatggtggacgtgggggggcagcggtcggagcggaggaagtggatccactgcttt
gagaacgtgacgtccatcatgttcctcgtggccctgagtgagtacgaccaagtgctggtg
gagtcggacaacgagaaccgcatggaggagagcaaagccctgttccggaccatcatcacc
tacccctggttccagaactcctcggtcatcctgttcctcaacaagaaggacctgctggag
gacaagatcctgcactcccacctggtggactacttcccggagttcgacgggccacagcgg
gacgcccaggccgcccgggagttcatcctgaagatgttcgtggacctgaaccccgacagc
gacaagatcatctactcccatttcacatgcgccaccgacacggagaacatccgcttcgtg
ttcgcggccgtcaaggacaccatcctgcagctcaacctgaaggagtacaacctcgtgtga

KEGG   Felis catus (domestic cat): 101094708Help
Entry
101094708         CDS       T02385                                 

Gene name
GNAQ
Definition
(RefSeq) guanine nucleotide-binding protein G(q) subunit alpha isoform X2
  KO
K04634  guanine nucleotide-binding protein G(q) subunit alpha
Organism
fca  Felis catus (domestic cat)
Pathway
fca04015  Rap1 signaling pathway
fca04020  Calcium signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04071  Sphingolipid signaling pathway
fca04261  Adrenergic signaling in cardiomyocytes
fca04270  Vascular smooth muscle contraction
fca04371  Apelin signaling pathway
fca04540  Gap junction
fca04611  Platelet activation
fca04713  Circadian entrainment
fca04720  Long-term potentiation
fca04723  Retrograde endocannabinoid signaling
fca04724  Glutamatergic synapse
fca04725  Cholinergic synapse
fca04726  Serotonergic synapse
fca04728  Dopaminergic synapse
fca04730  Long-term depression
fca04750  Inflammatory mediator regulation of TRP channels
fca04911  Insulin secretion
fca04912  GnRH signaling pathway
fca04915  Estrogen signaling pathway
fca04916  Melanogenesis
fca04918  Thyroid hormone synthesis
fca04921  Oxytocin signaling pathway
fca04922  Glucagon signaling pathway
fca04924  Renin secretion
fca04925  Aldosterone synthesis and secretion
fca04927  Cortisol synthesis and secretion
fca04928  Parathyroid hormone synthesis, secretion and action
fca04934  Cushing syndrome
fca04961  Endocrine and other factor-regulated calcium reabsorption
fca04970  Salivary secretion
fca04971  Gastric acid secretion
fca04972  Pancreatic secretion
fca05010  Alzheimer disease
fca05016  Huntington disease
fca05142  Chagas disease (American trypanosomiasis)
fca05143  African trypanosomiasis
fca05146  Amoebiasis
fca05163  Human cytomegalovirus infection
fca05170  Human immunodeficiency virus 1 infection
fca05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101094708 (GNAQ)
   04371 Apelin signaling pathway
    101094708 (GNAQ)
   04020 Calcium signaling pathway
    101094708 (GNAQ)
   04071 Sphingolipid signaling pathway
    101094708 (GNAQ)
   04022 cGMP-PKG signaling pathway
    101094708 (GNAQ)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101094708 (GNAQ)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101094708 (GNAQ)
  09152 Endocrine system
   04911 Insulin secretion
    101094708 (GNAQ)
   04922 Glucagon signaling pathway
    101094708 (GNAQ)
   04912 GnRH signaling pathway
    101094708 (GNAQ)
   04915 Estrogen signaling pathway
    101094708 (GNAQ)
   04921 Oxytocin signaling pathway
    101094708 (GNAQ)
   04918 Thyroid hormone synthesis
    101094708 (GNAQ)
   04928 Parathyroid hormone synthesis, secretion and action
    101094708 (GNAQ)
   04916 Melanogenesis
    101094708 (GNAQ)
   04924 Renin secretion
    101094708 (GNAQ)
   04925 Aldosterone synthesis and secretion
    101094708 (GNAQ)
   04927 Cortisol synthesis and secretion
    101094708 (GNAQ)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101094708 (GNAQ)
   04270 Vascular smooth muscle contraction
    101094708 (GNAQ)
  09154 Digestive system
   04970 Salivary secretion
    101094708 (GNAQ)
   04971 Gastric acid secretion
    101094708 (GNAQ)
   04972 Pancreatic secretion
    101094708 (GNAQ)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    101094708 (GNAQ)
  09156 Nervous system
   04724 Glutamatergic synapse
    101094708 (GNAQ)
   04725 Cholinergic synapse
    101094708 (GNAQ)
   04728 Dopaminergic synapse
    101094708 (GNAQ)
   04726 Serotonergic synapse
    101094708 (GNAQ)
   04720 Long-term potentiation
    101094708 (GNAQ)
   04730 Long-term depression
    101094708 (GNAQ)
   04723 Retrograde endocannabinoid signaling
    101094708 (GNAQ)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101094708 (GNAQ)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101094708 (GNAQ)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101094708 (GNAQ)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101094708 (GNAQ)
   05016 Huntington disease
    101094708 (GNAQ)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101094708 (GNAQ)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101094708 (GNAQ)
   05163 Human cytomegalovirus infection
    101094708 (GNAQ)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101094708 (GNAQ)
   05142 Chagas disease (American trypanosomiasis)
    101094708 (GNAQ)
   05143 African trypanosomiasis
    101094708 (GNAQ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101094708 (GNAQ)
   04031 GTP-binding proteins [BR:fca04031]
    101094708 (GNAQ)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101094708 (GNAQ)
GTP-binding proteins [BR:fca04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 3 (Gq/11) [OT]
    101094708 (GNAQ)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-alpha Arf
Motif
Other DBs
NCBI-GeneID: 101094708
NCBI-ProteinID: XP_019671353
Ensembl: ENSFCAG00000008471
Position
D4
AA seq 322 aa AA seqDB search
MANPFGGRGTGESGKSTFIKQMRIIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTL
KIPYKYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDST
KYYLNDLDRVADPAYLPTQQDVLRVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWI
HCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKD
LLEEKIMYSHLVDYFPEYDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENI
RFVFAAVKDTILQLNLKEYNLV
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatcccttcgggggaagagggacaggagagagcggcaagagtacgtttatcaag
cagatgagaatcatccatgggtcaggctactctgatgaagacaaaaggggcttcaccaag
ctggtgtatcagaacatcttcacggccatgcaggctatgatcagagccatggacacgctc
aagatcccctacaagtacgagcacaataaggctcatgcacaattagttcgagaagtcgat
gtggagaaggtgtctgctttcgagaatccatacgtagatgcaataaagagtttatggaat
gatcctggaatccaggaatgctatgatagacgacgagaatatcagttgtctgactctacc
aaatactatcttaatgacttggaccgtgttgccgaccccgcctacctgcctacgcaacaa
gatgtgcttagagttcgagtccccaccacagggatcatcgaatacccctttgacttacaa
agtgtcattttcagaatggtcgatgtagggggccagaggtcagagagaagaaaatggata
cactgctttgaaaatgtcacctctatcatgtttctagtagcgcttagtgaatatgatcaa
gttctcgtggagtcggacaatgagaaccgaatggaggaaagcaaagcactctttagaaca
attatcacatatccctggttccagaactcctcggttattctattcttaaacaagaaagat
cttctagaggagaaaattatgtattcccacctagttgactacttcccagaatatgatgga
ccccagagagatgcccaggcagctcgagaattcatcctgaagatgttcgtggacctgaac
cctgacagtgacaaaattatctactcccacttcacatgcgccacagataccgagaacatc
cgctttgtctttgccgccgtcaaggacaccatcctccagttgaacctgaaggagtacaat
ctggtctaa

DBGET integrated database retrieval system