KEGG   Felis catus (domestic cat): 101086544Help
Entry
101086544         CDS       T02385                                 

Gene name
IKBKG
Definition
(RefSeq) NF-kappa-B essential modulator isoform X1
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
fca  Felis catus (domestic cat)
Pathway
fca01523  Antifolate resistance
fca04010  MAPK signaling pathway
fca04014  Ras signaling pathway
fca04062  Chemokine signaling pathway
fca04064  NF-kappa B signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04210  Apoptosis
fca04380  Osteoclast differentiation
fca04620  Toll-like receptor signaling pathway
fca04621  NOD-like receptor signaling pathway
fca04622  RIG-I-like receptor signaling pathway
fca04623  Cytosolic DNA-sensing pathway
fca04625  C-type lectin receptor signaling pathway
fca04657  IL-17 signaling pathway
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04660  T cell receptor signaling pathway
fca04662  B cell receptor signaling pathway
fca04668  TNF signaling pathway
fca04920  Adipocytokine signaling pathway
fca05142  Chagas disease (American trypanosomiasis)
fca05145  Toxoplasmosis
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05162  Measles
fca05163  Human cytomegalovirus infection
fca05164  Influenza A
fca05165  Human papillomavirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05200  Pathways in cancer
fca05203  Viral carcinogenesis
fca05212  Pancreatic cancer
fca05215  Prostate cancer
fca05220  Chronic myeloid leukemia
fca05221  Acute myeloid leukemia
fca05222  Small cell lung cancer
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
fca05340  Primary immunodeficiency
fca05418  Fluid shear stress and atherosclerosis
Module
fca_M00686  Toll-like receptor signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101086544 (IKBKG)
   04010 MAPK signaling pathway
    101086544 (IKBKG)
   04064 NF-kappa B signaling pathway
    101086544 (IKBKG)
   04668 TNF signaling pathway
    101086544 (IKBKG)
   04151 PI3K-Akt signaling pathway
    101086544 (IKBKG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101086544 (IKBKG)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101086544 (IKBKG)
   04621 NOD-like receptor signaling pathway
    101086544 (IKBKG)
   04622 RIG-I-like receptor signaling pathway
    101086544 (IKBKG)
   04623 Cytosolic DNA-sensing pathway
    101086544 (IKBKG)
   04625 C-type lectin receptor signaling pathway
    101086544 (IKBKG)
   04660 T cell receptor signaling pathway
    101086544 (IKBKG)
   04658 Th1 and Th2 cell differentiation
    101086544 (IKBKG)
   04659 Th17 cell differentiation
    101086544 (IKBKG)
   04657 IL-17 signaling pathway
    101086544 (IKBKG)
   04662 B cell receptor signaling pathway
    101086544 (IKBKG)
   04062 Chemokine signaling pathway
    101086544 (IKBKG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101086544 (IKBKG)
  09158 Development
   04380 Osteoclast differentiation
    101086544 (IKBKG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101086544 (IKBKG)
   05203 Viral carcinogenesis
    101086544 (IKBKG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101086544 (IKBKG)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101086544 (IKBKG)
   05221 Acute myeloid leukemia
    101086544 (IKBKG)
   05220 Chronic myeloid leukemia
    101086544 (IKBKG)
   05215 Prostate cancer
    101086544 (IKBKG)
   05222 Small cell lung cancer
    101086544 (IKBKG)
  09163 Immune disease
   05340 Primary immunodeficiency
    101086544 (IKBKG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101086544 (IKBKG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101086544 (IKBKG)
   05170 Human immunodeficiency virus 1 infection
    101086544 (IKBKG)
   05162 Measles
    101086544 (IKBKG)
   05164 Influenza A
    101086544 (IKBKG)
   05161 Hepatitis B
    101086544 (IKBKG)
   05160 Hepatitis C
    101086544 (IKBKG)
   05168 Herpes simplex virus 1 infection
    101086544 (IKBKG)
   05163 Human cytomegalovirus infection
    101086544 (IKBKG)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101086544 (IKBKG)
   05169 Epstein-Barr virus infection
    101086544 (IKBKG)
   05165 Human papillomavirus infection
    101086544 (IKBKG)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101086544 (IKBKG)
   05142 Chagas disease (American trypanosomiasis)
    101086544 (IKBKG)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    101086544 (IKBKG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101086544 (IKBKG)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   101086544 (IKBKG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CC2-LZ NEMO zf_C2H2_10 zf_C2H2_ZHX LLC1 Golgin_A5
Motif
Other DBs
NCBI-GeneID: 101086544
NCBI-ProteinID: XP_004001080
UniProt: M3X2Y1
Position
X
AA seq 419 aa AA seqDB search
MSRPPWKSQLCEMVQPSGGPAGDQDVLGEESSLGKPAMPHLPSEQGTPETFQRCVEENQE
LRDAIRQSNQMLRERCEELQRFQGSQRKEKEFLMQKFQEARKLVERLSLEKLDLRRQREQ
ALQEVEHLKRCQKQLAEDKASVKAQVTSLLGELQESQSRLEAAIKERQALEGRARAASEQ
ARQLESEREALQQQHSVQVDQLRMQSQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQE
YDSHIKSSVVSSERNRGLQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPV
LKAQADIYKADFQAERQAREKLAEKKEILQEQLAQLQRDYSRLKASCQESARIEDMRKRH
VEASQAPVAPAPAHPSFHLALPNQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgagcaggcccccctggaagagtcagctgtgtgagatggtgcagcccagcggcggcccg
gcaggggaccaggacgtgctgggtgaagagtcttctctggggaagccagctatgccccac
ctaccttctgagcagggcactcctgagaccttccaacgctgtgtggaggagaatcaagag
ctccgagatgccatccggcagagcaaccagatgcttcgggagcgctgtgaggagctgcag
cgtttccaaggcagccagaggaaggagaaggagttcctcatgcagaaattccaggaagcc
aggaaactggtggagagactgagcctggagaagctcgacctgaggaggcagagggagcaa
gccctgcaggaggtggaacatctgaagagatgccagaagcagttggctgaggacaaggcg
tcagtgaaagcccaggtgacgtccttgctgggggagctccaagagagccagagtcgcttg
gaggccgccatcaaagagcggcaggctttggagggcagggcccgggctgccagcgagcag
gcccggcagctggagagcgagcgggaggccctgcagcagcagcacagcgtgcaggtggac
cagctgcgcatgcagagccagagcgtggaggccgcgctgcgcatggagcgccaggccgcc
tcggaggagaagcggaagctggcgcagctacaggtggcctatcaccagctcttccaggag
tacgacagccacatcaagagcagcgtggtgagcagcgagcggaaccgaggactgcagctg
gaggacctgaagcagcagctgcaacaggccgaggaggccctggtggccaagcaggaagtg
attgacaagctgaaggaagaggccgagcagcacaagatagtgatggagaccgttccggtg
ctaaaagcccaggcggacatctacaaggccgacttccaggccgagaggcaggcccgggag
aagctggccgagaagaaggagattctgcaggagcagctggcccagctgcagcgggactac
agccgcctgaaggccagctgccaggagtccgccaggattgaagatatgaggaagcggcac
gtggaggcctcccaggcccccgtagcccctgccccagctcacccctccttccacctggcc
ctgcccaaccagaggagaagcccccccgaggagccgcctgacttctgttgccccaagtgc
cagtatcaggctcccgatatggacaccctgcagatacatgtcatggagtgcatcgagtag

DBGET integrated database retrieval system