KEGG   Felis catus (domestic cat): 101086703Help
Entry
101086703         CDS       T02385                                 

Definition
(RefSeq) cytochrome b-c1 complex subunit 10
  KO
K00420  ubiquinol-cytochrome c reductase subunit 10
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04260  Cardiac muscle contraction
fca04714  Thermogenesis
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00152  Cytochrome bc1 complex
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101086703
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    101086703
  09159 Environmental adaptation
   04714 Thermogenesis
    101086703
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101086703
   05012 Parkinson disease
    101086703
   05016 Huntington disease
    101086703
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101086703
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCR_6-4kD QCR10
Motif
Other DBs
NCBI-GeneID: 101086703
NCBI-ProteinID: XP_003981660
Ensembl: ENSFCAG00000002620
UniProt: A0A2I2U6J7
Position
A2
AA seq 56 aa AA seqDB search
MLSRFLGPRYRELARNWIPTAGMWGAVGAVGLVWATDWRLILDWVPYINGKFKKDD
NT seq 171 nt NT seq  +upstreamnt  +downstreamnt
atgctgagcaggttcctgggcccgcgctaccgcgagctggccagaaactggattcccaca
gcaggcatgtggggcgccgtgggcgccgtggggctggtgtgggccacggattggcggctc
attctggactgggtgccctacatcaacggcaagtttaagaaggacgattag

KEGG   Felis catus (domestic cat): 101089499Help
Entry
101089499         CDS       T02385                                 

Definition
(RefSeq) cytochrome b-c1 complex subunit 1, mitochondrial isoform X2
  KO
K00414  ubiquinol-cytochrome c reductase core subunit 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04260  Cardiac muscle contraction
fca04714  Thermogenesis
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00152  Cytochrome bc1 complex
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101089499
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    101089499
  09159 Environmental adaptation
   04714 Thermogenesis
    101089499
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101089499
   05012 Parkinson disease
    101089499
   05016 Huntington disease
    101089499
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101089499
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:fca01002]
    101089499
Peptidases [BR:fca01002]
 Metallo Peptidases
  Family M16: pitrilysin family
   101089499
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M16 Peptidase_M16_C DUF3483
Motif
Other DBs
NCBI-GeneID: 101089499
NCBI-ProteinID: XP_003982215
Ensembl: ENSFCAG00000002100
UniProt: M3VXW7
Position
A2
AA seq 480 aa AA seqDB search
MAASAVCRAASAGTRVLLRTHRSPALLRSPALRTTATFAQALQSVPETQVSLLDNGLRVA
SEQSSQPTCTVGVWIDVGSRYETEKNNGAGYFLEHLAFKGTKNRPGNALEKEVESMGAHL
NAYSTREHTAYYIKALSKDLPKAVELLADIVQNCALEDSQIEKERDVILQELQENDACMR
DVVFDYLHATAFQGTPLAQAVEGPSGNVRKLSRADLTEYVSRHYKAPRMVLAAAGGVEHR
QLVDLAQKHFSSVSETYTEDAVPTLAPCRFTGSEIRHRDDALPLAHVAIAVEGPGWANPD
NVALQVANAIIGHYDCTYGGGMHLSSPLAAVAVANKLCQSFQTFNICYADTGLLGAHFVC
DRMKIDDMMFFLQGQWMRLCTSATESEVLRGKNILRNALVSHLDGTTPVCEDIGRSLLTY
GRRIPLAEWESRIAEVDASVVRDVCSKYFYDQCPAVAGFGPIEQLPDYNRIRSGMFWLRF
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggcggcttccgcagtttgccgggcggctagcgccgggactcgagtgctgcttcgcacc
caccgctcgccggccctgctgaggtcgcctgccttgaggaccaccgccaccttcgctcaa
gctctccagagcgtgccggagacacaggtcagcttgctggacaacgggctgagagtggcc
tccgagcagtcctcccagcctacctgcacggtcggggtatggattgatgttggcagccgt
tacgagactgagaagaacaacggggcaggttactttctggagcatctggctttcaaggga
acaaaaaatcggcctggcaatgccttggagaaggaggtggagagcatgggggcccatctc
aatgcctacagcacccgggagcacacagcatactacatcaaggcgctatccaaggacctg
ccaaaagctgtggagctcctggccgacattgtgcagaactgtgccctagaagactcccag
attgagaaggagcgtgatgtgatcctacaggagctgcaggagaatgatgcatgtatgcgg
gacgtggtctttgactacctgcacgccacagcattccagggcacacctctagcccaggct
gtggaggggcccagtgggaatgtcaggaagctatctcgtgcagacctgaccgagtatgtc
agcaggcattacaaggcccctcgcatggtgctcgcagcagccggaggggtggagcaccgg
cagctggtagatctcgcccagaagcacttcagcagcgtctctgagacatacacagaggac
gctgtgcccactcttgctccatgccgcttcactggcagcgagatccgccaccgcgacgat
gctctgccattggcccatgtggctattgcggtagaggggcctggctgggccaacccggac
aacgtggccctccaagtagccaatgccatcattggccactatgactgcacttatggtggt
ggcatgcacctgtccagcccactggctgcagtcgccgtggccaacaagctgtgccagagt
ttccagaccttcaatatctgctacgcagacactgggttgctgggtgcacactttgtctgc
gatcgcatgaaaatcgatgacatgatgttcttcctgcaaggccagtggatgcgcctgtgc
accagtgccacagagagtgaggtgctccggggcaaaaacatcctccgaaatgccctggtg
tctcatctggatggcaccactcctgtgtgtgaggacatcggacgtagtctcctgacctat
ggccgccgcattcccctggctgagtgggaaagccggattgcggaagtggatgccagtgtg
gtacgtgatgtctgctccaagtacttctatgatcagtgtccagcagtggctggatttggc
cccattgagcagctcccagactacaaccggatccgtagcggcatgttctggctgcgtttc
tag

KEGG   Felis catus (domestic cat): 101090590Help
Entry
101090590         CDS       T02385                                 

Definition
(RefSeq) cytochrome b-c1 complex subunit 7
  KO
K00417  ubiquinol-cytochrome c reductase subunit 7
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04260  Cardiac muscle contraction
fca04714  Thermogenesis
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00152  Cytochrome bc1 complex
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101090590
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    101090590
  09159 Environmental adaptation
   04714 Thermogenesis
    101090590
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101090590
   05012 Parkinson disease
    101090590
   05016 Huntington disease
    101090590
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101090590
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCR_14kD
Motif
Other DBs
NCBI-GeneID: 101090590
NCBI-ProteinID: XP_004000046
Ensembl: ENSFCAG00000026302
UniProt: M3XB84
Position
F2
AA seq 111 aa AA seqDB search
MASRPAVAASSRWLEGIRKWYYNAAGFNKLGLMRDDTIYENDDVKEAIRRLPENLYNDRM
FRIKRALDLTMRHQILPKEQWTKYEEDKFYLEPYLKEVIRERKEREEWAKK
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atggcgagccggcctgcggttgcagcatcaagtcggtggctggagggtattcgaaaatgg
tattacaatgctgcagggttcaataaactgggactaatgcgagatgatacaatatatgag
aatgacgatgtgaaagaggccataagaaggcttcctgagaacctttataatgacaggatg
tttcgcattaagagagcactggacctgaccatgaggcaccagatcttgcctaaagagcag
tggacaaaatatgaggaggataaattctaccttgaaccatatctgaaagaagttattcgg
gaaagaaaagaaagagaagaatgggcaaagaaataa

KEGG   Felis catus (domestic cat): 101094239Help
Entry
101094239         CDS       T02385                                 

Definition
(RefSeq) cytochrome c1, heme protein, mitochondrial
  KO
K00413  ubiquinol-cytochrome c reductase cytochrome c1 subunit
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04260  Cardiac muscle contraction
fca04714  Thermogenesis
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00151  Cytochrome bc1 complex respiratory unit
fca_M00152  Cytochrome bc1 complex
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101094239
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    101094239
  09159 Environmental adaptation
   04714 Thermogenesis
    101094239
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101094239
   05012 Parkinson disease
    101094239
   05016 Huntington disease
    101094239
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101094239
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C1 Cytochrome_CBB3 Cytochrom_C
Motif
Other DBs
NCBI-GeneID: 101094239
NCBI-ProteinID: XP_004000264
Ensembl: ENSFCAG00000011545
Position
F2
AA seq 325 aa AA seqDB search
MAAAAASLRGAVLGPRGAGLPGARARSLLCGARPCQLPLRTPQAVSLSSKAGLSRGRKVM
LSALGMLAAGGAGLAVALHSAVSASDLELHPPSYPWSHRGFLSSLDHTSIRRGFQVYKQV
CSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYP
NPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQ
AIGMAPPIYTEVLEYDDGTPATMSQVAKDVCTFLRWASEPEHDHRKRMGLKMLMMMGLLL
PLVYAMKRHKWSVLKSRKLAYRPPK
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggcggcttcgcttcgcggggcggtgctgggcccgcggggcgcggggctg
ccgggcgcgcgggcccggagtttgctgtgcggcgcgcggccctgccagctcccgctgcgg
acgccacaggcagtgtccttgtcgtcgaaggccggtctgtcccggggccggaaagtgatg
ctctcagcgttgggcatgctggcggcagggggtgcagggctagccgtggctctgcattcg
gccgtgagcgccagtgacctggagctgcacccccccagctatccgtggtcccaccgtggc
ttcctgtcttccctggaccacaccagtatccggaggggtttccaggtgtataagcaggtg
tgctcctcctgccacagcatggactacgtggcctaccgccacctggtgggtgtctgctac
acagaagatgaagctaaggcgctcgcagaagaggtggaggttcaggacggccccaacgag
gatggggagatgttcatgcggccagggaagctgtctgactacttccccaagccctacccc
aaccctgaggccgctcgagcagccaacaacggagcactgccccctgacctcagctacatc
gtgcgagctaggcacggtggtgaggactacgtcttctccctgctaaccggctactgtgag
ccgcccaccggtgtgtcattgcgagaaggtctctatttcaacccctactttcctggccag
gccatcggcatggctcctcccatctacactgaggtcttggagtatgacgatggcacccca
gctaccatgtcccaggtagccaaggatgtgtgtaccttcctgcgctgggcatccgagcca
gagcatgaccatcgcaaacgcatggggctcaagatgttgatgatgatgggcttgctattg
cctctggtctatgccatgaagcggcataagtggtcagtcctgaagagccggaagctggcg
tatcggccacccaagtga

KEGG   Felis catus (domestic cat): 101094311Help
Entry
101094311         CDS       T02385                                 

Definition
(RefSeq) cytochrome b-c1 complex subunit Rieske, mitochondrial
  KO
K00411  ubiquinol-cytochrome c reductase iron-sulfur subunit [EC:7.1.1.8]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04260  Cardiac muscle contraction
fca04714  Thermogenesis
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00151  Cytochrome bc1 complex respiratory unit
fca_M00152  Cytochrome bc1 complex
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101094311
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    101094311
  09159 Environmental adaptation
   04714 Thermogenesis
    101094311
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101094311
   05012 Parkinson disease
    101094311
   05016 Huntington disease
    101094311
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101094311
Enzymes [BR:fca01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.8  quinol---cytochrome-c reductase
     101094311
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCR_TM Ubiq-Cytc-red_N Rieske
Motif
Other DBs
NCBI-GeneID: 101094311
NCBI-ProteinID: XP_003998010
Ensembl: ENSFCAG00000027292
UniProt: M3X4Y3
Position
E2
AA seq 274 aa AA seqDB search
MLSVAARSGPFAPVLSATSRGVAGALRPLVQASVPATSEPPVLDVKRPFLCRESLSGQAA
SRPLVASVGLNVPASVRYSHTDIRVPDFSDYRRTEVLDGTKSSKESSEARKGFSYLITAT
TSIGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRT
KKEIEQEAAVEVSQLRDPQHDLDRVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHG
SHYDASGRIRKGPAPLNLEVPSYEFTGDDMVIVG
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcggtggccgcccgttcgggcccgttcgcgcccgtcctatcggccacgtcccgc
ggggtggcgggcgcgttgcggcctctggtgcaggcttcagtgcccgccacctcggagccg
ccagtgctggacgtgaagcggcccttcctgtgccgggagtcgctgagtggccaggccgcg
agccggcctttggtcgcctccgtgggcctcaatgtccctgcttctgttcgttattcccac
acagacatcagagtgcctgacttctctgactatcgacgcaccgaagtgttagatggtaca
aagtcttcaaaagagagcagtgaggctagaaaaggtttctcctatttgataactgcaaca
actagtataggtgttgcatatgctgccaagaatgtcgtctcccagtttgtttccagcatg
agtgcttctgctgatgtgttggccatgtcgaaaatcgaaatcaagctatccgatattcca
gaaggcaagaacatggctttcaaatggagaggaaaaccgctgtttgtgcgtcatagaacc
aagaaggaaattgagcaggaagctgcagttgaagtgtcccagttgagggacccgcagcat
gatttagatcgagtaaagaaacctgaatgggttatcctgataggtgtttgcactcatctt
ggttgtgtacccattgcaaatgcaggagattttggtggttattactgcccttgccatggg
tcacactatgatgcttctggcaggatcaggaaggggcctgcacctctcaatcttgaagtt
ccctcatatgagttcaccggtgatgacatggtgattgttggttag

KEGG   Felis catus (domestic cat): 101095032Help
Entry
101095032         CDS       T02385                                 

Definition
(RefSeq) cytochrome b-c1 complex subunit 6, mitochondrial isoform X1
  KO
K00416  ubiquinol-cytochrome c reductase subunit 6
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04260  Cardiac muscle contraction
fca04714  Thermogenesis
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00152  Cytochrome bc1 complex
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101095032
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    101095032
  09159 Environmental adaptation
   04714 Thermogenesis
    101095032
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101095032
   05012 Parkinson disease
    101095032
   05016 Huntington disease
    101095032
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101095032
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCR_hinge Syntaxin-6_N
Motif
Other DBs
NCBI-GeneID: 101095032
NCBI-ProteinID: XP_003990099
Ensembl: ENSFCAG00000003451
UniProt: A0A337SWK8
Position
C1
AA seq 91 aa AA seqDB search
MGLEDERKMLTGSGDPKEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSR
SKTEEDCTEELFDFLHARDHCVAHKLFNSLK
NT seq 276 nt NT seq  +upstreamnt  +downstreamnt
atggggctggaggacgagcgaaagatgctgactgggtccggagaccccaaagaggaggaa
gaggaggaggaggaattagtggatcctctaacaacggtgagagagcaatgcgagcagctg
gagaaatgtgtaaaggctcgggagcggctagagctctgtgatgagcgcgtatcctccagg
tcaaagacagaggaggattgcacagaggagctctttgacttcctgcatgcaagggaccat
tgtgtggcccacaaactctttaacagcttgaaataa

KEGG   Felis catus (domestic cat): 101096871Help
Entry
101096871         CDS       T02385                                 

Definition
(RefSeq) cytochrome b-c1 complex subunit 8
  KO
K00418  ubiquinol-cytochrome c reductase subunit 8
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04260  Cardiac muscle contraction
fca04714  Thermogenesis
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00152  Cytochrome bc1 complex
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101096871
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    101096871
  09159 Environmental adaptation
   04714 Thermogenesis
    101096871
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101096871
   05012 Parkinson disease
    101096871
   05016 Huntington disease
    101096871
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101096871
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UcrQ Cyt_b-c1_8
Motif
Other DBs
NCBI-GeneID: 101096871
NCBI-ProteinID: XP_003980807
Ensembl: ENSFCAG00000024071
UniProt: M3X026
Position
A1
AA seq 82 aa AA seqDB search
MGREFGHLTRMRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVLPPFVGFYLVY
TWGTQEFEKSKRKNPAAYENDK
NT seq 249 nt NT seq  +upstreamnt  +downstreamnt
atgggccgcgagtttgggcatctgacgcggatgcggcatgtgatcacctacagcttgtca
cccttcgagcagcgcgccttcccgcactacttcagcaagggcatccccaacgtgctgcgc
cgcacgcgggcgtgcatccttcgcgtcctgccgccgtttgtagggttttatcttgtctat
acctgggggacccaggagtttgagaaatccaagaggaagaatccggctgcttatgaaaat
gacaaatga

KEGG   Felis catus (domestic cat): 101101684Help
Entry
101101684         CDS       T02385                                 

Definition
(RefSeq) cytochrome b-c1 complex subunit 2, mitochondrial
  KO
K00415  ubiquinol-cytochrome c reductase core subunit 2
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04260  Cardiac muscle contraction
fca04714  Thermogenesis
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00152  Cytochrome bc1 complex
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101101684
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    101101684
  09159 Environmental adaptation
   04714 Thermogenesis
    101101684
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101101684
   05012 Parkinson disease
    101101684
   05016 Huntington disease
    101101684
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101101684
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:fca01002]
    101101684
Peptidases [BR:fca01002]
 Metallo Peptidases
  Family M16: pitrilysin family
   101101684
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M16 Peptidase_M16_C
Motif
Other DBs
NCBI-GeneID: 101101684
NCBI-ProteinID: XP_003998825
UniProt: M3W8B7
Position
E3
AA seq 453 aa AA seqDB search
MKLLSRAGSFSRFYSLKVAPKVKTTAAPAGVPPLPQDLEFTKLPNGLVIASLENYAPASR
IGLFIKAGSRYEDSNNLGTSHLLRLASSLTTKGASSFKITRGIEAVGGKLSVTSTRENMA
YTVECLRDDVDILMEFLLNVTTAPEFRRWEVADLQSQLRIDKAVAFQNPQARVIENLHAA
AYRNALANSLYCPDYRIGKVTPDELHNYVQNHFTSARMALIGLGVSHPVLKQVAEQFLNM
RGGLGLPSTKARYRGGEIREQNGDSLVHAALVAESATIGSAEANAFSVLQYVLGAGPHVK
RGSNATSSLYQAVAKGVHQPFDVSAFNASYSDSGLFGIYTISQAAAAGDVIKAAYNQVKM
IAQGNLSNTDVLAAKNKLKAGYLMSVESSEEFLDEVGSQALVAGSYTPPATVLQQIDSVA
DTDVVNAAKKFVSGRKSMAASGNLGHTPFVDEL
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgctaagcagagccgggtctttttcgaggttttattccctgaaagttgctccc
aaagtgaagaccacagctgcccctgcaggagtgcctccgcttcctcaggaccttgagttt
accaagttaccaaatggcttagtgattgcttctctggaaaactatgctcctgcatcaaga
attggtttgttcattaaagcaggcagtagatatgaggactccaacaacttaggaacctct
catttgcttcgtcttgcatccagtttgactacaaaaggagcttcatctttcaagataacc
cgtggaattgaagcagttggtggtaaattaagtgtgacttcaaccagggaaaacatggcc
tacactgtggaatgtctgcgagatgatgttgatattctaatggagttcctgctcaatgtc
accacagccccagaatttcgtcgttgggaagtagctgaccttcagtctcagctaaggatt
gacaaagctgtggcttttcagaatccacaggctcgtgtcattgaaaatttgcatgctgca
gcttaccgaaatgccttggctaattccctgtattgccctgattataggattggaaaagtg
acaccagatgagttacataactatgtgcagaaccattttacaagtgcgagaatggctttg
atcggacttggtgtgagtcatcctgttctaaagcaagttgctgaacagtttctcaacatg
aggggtgggcttggtttacctagtacaaaggccagatatcgtggaggtgaaatccgagag
cagaacggagacagcctcgtccatgctgcccttgtagcagaaagtgctacaataggaagt
gcagaagcaaatgcatttagtgttctccagtatgtccttggtgctggaccacacgtcaag
aggggcagcaatgctaccagctctctgtaccaggccgttgccaagggagttcaccagcca
tttgatgtttccgcttttaatgccagttactcggattctggactctttgggatttatacc
atttcacaggctgctgcagctggagatgttatcaaggccgcctataaccaagtaaaaatg
attgctcaaggaaacctttccaatacagatgtcctagctgccaagaacaagctgaaagct
ggctacctaatgtcagtggagtcttctgaggagttcctggatgaagtcgggtcccaggct
ctggttgctggttcatacacaccaccagccacagtccttcagcagattgactccgtagca
gacacagatgttgtaaatgctgcaaagaagtttgtttctggccggaagtcaatggcagca
agtggaaatctggggcacacacctttcgttgatgagttgtaa

KEGG   Felis catus (domestic cat): 105261050Help
Entry
105261050         CDS       T02385                                 

Definition
(RefSeq) cytochrome b-c1 complex subunit 9 isoform X1
  KO
K00419  ubiquinol-cytochrome c reductase subunit 9
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04260  Cardiac muscle contraction
fca04714  Thermogenesis
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00152  Cytochrome bc1 complex
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    105261050
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    105261050
  09159 Environmental adaptation
   04714 Thermogenesis
    105261050
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105261050
   05012 Parkinson disease
    105261050
   05016 Huntington disease
    105261050
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    105261050
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCR_UQCRX_QCR9
Motif
Other DBs
NCBI-GeneID: 105261050
NCBI-ProteinID: XP_011286040
Position
D3
AA seq 63 aa AA seqDB search
MAAPTFTARLYSLLFRRTSTFALTIAVGALFFERAFDQGADAIYEHINEGKLWKHIKHKY
ENK
NT seq 192 nt NT seq  +upstreamnt  +downstreamnt
atggcggccccgacgtttactgcgaggttatactccctgttgttccgcaggacctccact
ttcgccctcaccatcgccgtgggcgctttgttcttcgagcgcgccttcgaccaaggcgcg
gacgcgatctacgaacacatcaacgaggggaagctgtggaaacacatcaagcacaagtat
gagaataagtag

KEGG   Felis catus (domestic cat): 807931Help
Entry
807931            CDS       T02385                                 

Gene name
CYTB
Definition
(RefSeq) cytochrome b
  KO
K00412  ubiquinol-cytochrome c reductase cytochrome b subunit
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04260  Cardiac muscle contraction
fca04714  Thermogenesis
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00151  Cytochrome bc1 complex respiratory unit
fca_M00152  Cytochrome bc1 complex
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    807931 (CYTB)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    807931 (CYTB)
  09159 Environmental adaptation
   04714 Thermogenesis
    807931 (CYTB)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    807931 (CYTB)
   05012 Parkinson disease
    807931 (CYTB)
   05016 Huntington disease
    807931 (CYTB)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    807931 (CYTB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:fca03029]
    807931 (CYTB)
Mitochondrial biogenesis [BR:fca03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   Mitochondrial respiratory chain complex III
    807931 (CYTB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrome_B Cytochrom_B_N_2 Cytochrom_B_C
Motif
Other DBs
NCBI-GeneID: 807931
NCBI-ProteinID: NP_008263
UniProt: P48886
Position
MT
AA seq 379 aa AA seqDB search
MTNIRKSHPLIKIINHSFIDLPAPSNISAWWNFGSLLGVCLTLQILTGLFLAMHYTSDTM
TAFSSVTHICRDVNYGWIIRYLHANGASMFFICLYMHVGRGMYYGSYTFSETWNIGIMLL
FTVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTELVEWIWGGFSVDKATLTRFFG
FHFILPFIISALAGVHLLFLHETGSNNPSGITSDSDKIPFHPYYTIKDILGLLVLVLTLM
LLVLFSPDLLGDPDNYIPANPLNTPPHIKPEWYFLFAYAILRSIPNKLGGVLALVLSILV
LAIIPILHTSKQRGMMFRPLSQCLFWLLVADLLTLTWIGGQPVEHPFITIGQLASILYFS
TLLILMPISGIIENRLLKW
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaccaacattcgaaaatcacacccccttatcaaaattattaatcactcattcatcgat
ctacccgccccatctaacatctcagcatgatgaaacttcggctcccttctaggagtctgc
ctaaccttacaaatcctcaccggcctctttttggccatacactacacatcagacacaata
accgccttttcatcagttacccacatctgtcgcgacgttaattatggctgaatcatccga
tatttacacgccaacggagcttctatattctttatctgcctgtacatacatgtaggacgg
ggaatatactacggctcctacaccttctcagagacatgaaacattggaatcatactatta
tttacagtcatagccacagcttttatgggatacgtcctaccatgaggccaaatgtccttc
tgaggagcaaccgtaatcactaacctcctgtcagcaattccatacatcgggactgaacta
gtagaatgaatctgaggggggttctcagtagacaaagccaccctaacacgattctttggc
ttccacttcattcttccattcattatctcagccttagcaggagtacacctcttattcctt
catgaaacaggatctaacaacccctcaggaattacatccgattcagacaaaatcccattc
cacccatactatacaatcaaagacatcctaggtcttctagtactagttttaacactcata
ctactcgtcctattttcaccagacctgctaggagacccagacaactacatcccagccaac
cctttaaatacccctccccatattaaacctgaatgatacttcctattcgcatacgcaatt
ctccgatccatccctaacaaactagggggagtcctagccctagtactctccatcctagta
ctagcaatcattccaatcctccacacctccaaacaacgaggaataatgtttcgaccacta
agccaatgtctattctgactcctagtagcggatctcctaaccctaacatgaatcggtggc
caacctgtagaacatccgttcatcaccatcgggcaactagcctccatcctatatttctca
accctcctaatcctaatacccatctcaggcattattgaaaaccgtctactcaaatgaaga

DBGET integrated database retrieval system