KEGG   Felis catus (domestic cat): 101086926Help
Entry
101086926         CDS       T02385                                 

Gene name
PPP3CB
Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit beta isoform isoform X1
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04020  Calcium signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04114  Oocyte meiosis
fca04218  Cellular senescence
fca04310  Wnt signaling pathway
fca04360  Axon guidance
fca04370  VEGF signaling pathway
fca04380  Osteoclast differentiation
fca04625  C-type lectin receptor signaling pathway
fca04650  Natural killer cell mediated cytotoxicity
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04660  T cell receptor signaling pathway
fca04662  B cell receptor signaling pathway
fca04720  Long-term potentiation
fca04724  Glutamatergic synapse
fca04728  Dopaminergic synapse
fca04921  Oxytocin signaling pathway
fca04922  Glucagon signaling pathway
fca04924  Renin secretion
fca05010  Alzheimer disease
fca05014  Amyotrophic lateral sclerosis (ALS)
fca05031  Amphetamine addiction
fca05152  Tuberculosis
fca05163  Human cytomegalovirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05170  Human immunodeficiency virus 1 infection
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101086926 (PPP3CB)
   04310 Wnt signaling pathway
    101086926 (PPP3CB)
   04370 VEGF signaling pathway
    101086926 (PPP3CB)
   04020 Calcium signaling pathway
    101086926 (PPP3CB)
   04022 cGMP-PKG signaling pathway
    101086926 (PPP3CB)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101086926 (PPP3CB)
   04218 Cellular senescence
    101086926 (PPP3CB)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101086926 (PPP3CB)
   04650 Natural killer cell mediated cytotoxicity
    101086926 (PPP3CB)
   04660 T cell receptor signaling pathway
    101086926 (PPP3CB)
   04658 Th1 and Th2 cell differentiation
    101086926 (PPP3CB)
   04659 Th17 cell differentiation
    101086926 (PPP3CB)
   04662 B cell receptor signaling pathway
    101086926 (PPP3CB)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    101086926 (PPP3CB)
   04921 Oxytocin signaling pathway
    101086926 (PPP3CB)
   04924 Renin secretion
    101086926 (PPP3CB)
  09156 Nervous system
   04724 Glutamatergic synapse
    101086926 (PPP3CB)
   04728 Dopaminergic synapse
    101086926 (PPP3CB)
   04720 Long-term potentiation
    101086926 (PPP3CB)
  09158 Development
   04360 Axon guidance
    101086926 (PPP3CB)
   04380 Osteoclast differentiation
    101086926 (PPP3CB)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101086926 (PPP3CB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101086926 (PPP3CB)
   05014 Amyotrophic lateral sclerosis (ALS)
    101086926 (PPP3CB)
  09165 Substance dependence
   05031 Amphetamine addiction
    101086926 (PPP3CB)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101086926 (PPP3CB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101086926 (PPP3CB)
   05170 Human immunodeficiency virus 1 infection
    101086926 (PPP3CB)
   05163 Human cytomegalovirus infection
    101086926 (PPP3CB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101086926 (PPP3CB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:fca01009]
    101086926 (PPP3CB)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     101086926 (PPP3CB)
Protein phosphatases and associated proteins [BR:fca01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     101086926 (PPP3CB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Metallophos DUF5378
Motif
Other DBs
NCBI-GeneID: 101086926
NCBI-ProteinID: XP_023096316
Position
D2
AA seq 534 aa AA seqDB search
MAAPEPARAAPPPPPPPPPPPGADRVVKAVPFPPTHRLTSEEVFDMDGIPRVDVLKNHLV
KEGRVDEEIALRIINEGAAILRREKTMIEVEAPITVCGDIHGQFFDLMKLFEVGGSPANT
RYLFLGDYVDRGYFSIECVLYLWVLKILYPSTLFLLRGNHECRHLTEYFTFKQECKIKYS
ERVYEACMEAFDSLPLAALLNQQFLCVHGGLSPEIHTLDDIRRLDRFKEPPAFGPMCDLL
WSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQNNNLLSIIRAHEAQDAGYRMY
RKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFT
WSLPFVGEKVTEMLVNVLSICSDDELMTEGEDQFDERLIYGNKKVGSAAARKEIIRNKIR
AIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLAGGRQTLQSATVEAIEAEKAIRGF
SPPHRICSFEEAKGLDRINERMPPRKDAVQQDGFNSLNTAHATENHGTGNHSAQ
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atggccgccccggagccggcccgggctgcaccgcccccacccccgcccccgccgccccct
cccggggctgaccgcgtcgtcaaagctgtaccttttcccccaacacatcgcttgacatct
gaagaagtatttgatatggatgggatacccagggttgatgttctgaagaatcacttagta
aaagaaggtcgggtagatgaagaaattgcacttagaattatcaatgagggtgctgccatc
cttcggagagagaaaaccatgatagaagtagaggctccaattacagtgtgtggtgacatc
catggccaattttttgatctgatgaaactttttgaagtaggaggatcacctgctaataca
cgatacctttttcttggtgattatgtggacagaggttattttagtatagagtgtgtctta
tatttatgggtcctgaagattctttacccaagcacattatttcttctgagaggcaatcat
gaatgcagacaccttactgaatattttacctttaagcaggaatgtaaaattaaatattca
gaaagagtctatgaagcttgtatggaagcttttgatagcctgcctcttgctgcactttta
aatcaacaatttctttgtgttcatggtggactttcaccagaaatacacacactggatgat
attaggagattagatagattcaaagagccacctgcatttggaccaatgtgtgacttgcta
tggtccgatccttctgaagattttggaaatgaaaaatcacaggaacattttagtcacaat
acagttcgaggatgttcttatttttataactatccagcagtgtgtgaatttttgcaaaac
aataatttgttatcgattattagagctcatgaagctcaagatgcaggctatagaatgtac
agaaaaagtcaaactacagggttcccttcattaataacaattttttcggcacctaattac
ttagatgtctacaataataaagctgctgtattaaagtatgaaaataatgtgatgaatatt
cgacagtttaactgttctccacatccttactggttgcccaattttatggatgtcttcaca
tggtctttaccatttgttggagaaaaagtgacagaaatgttggtaaatgttctgagtatt
tgctctgatgatgaactgatgactgaaggtgaagaccaatttgatgaacggctcatatat
ggcaataaaaaagtaggttcagctgcagcccggaaagaaatcataagaaacaaaattcga
gcaattggcaagatggcaagggtcttctctgttctcagggaggagagtgaaagcgtgctg
acactcaagggcctgactcccacagggatgttgcctagtggagtgttggctggaggacga
cagaccctgcaaagtgccacagttgaggctattgaggctgaaaaagcaatacgaggattc
tctccaccacatagaatctgcagttttgaagaggcaaagggtttggataggatcaatgag
agaatgccaccccggaaagatgctgtacagcaagatggtttcaattctctgaacaccgca
catgccactgagaaccacgggactggcaaccatagtgcccagtga

KEGG   Felis catus (domestic cat): 101090344Help
Entry
101090344         CDS       T02385                                 

Gene name
PPP3R1
Definition
(RefSeq) calcineurin subunit B type 1 isoform X2
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04020  Calcium signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04114  Oocyte meiosis
fca04218  Cellular senescence
fca04310  Wnt signaling pathway
fca04360  Axon guidance
fca04370  VEGF signaling pathway
fca04380  Osteoclast differentiation
fca04625  C-type lectin receptor signaling pathway
fca04650  Natural killer cell mediated cytotoxicity
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04660  T cell receptor signaling pathway
fca04662  B cell receptor signaling pathway
fca04720  Long-term potentiation
fca04724  Glutamatergic synapse
fca04921  Oxytocin signaling pathway
fca04922  Glucagon signaling pathway
fca04924  Renin secretion
fca05010  Alzheimer disease
fca05014  Amyotrophic lateral sclerosis (ALS)
fca05031  Amphetamine addiction
fca05152  Tuberculosis
fca05163  Human cytomegalovirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05170  Human immunodeficiency virus 1 infection
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101090344 (PPP3R1)
   04310 Wnt signaling pathway
    101090344 (PPP3R1)
   04370 VEGF signaling pathway
    101090344 (PPP3R1)
   04020 Calcium signaling pathway
    101090344 (PPP3R1)
   04022 cGMP-PKG signaling pathway
    101090344 (PPP3R1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101090344 (PPP3R1)
   04218 Cellular senescence
    101090344 (PPP3R1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101090344 (PPP3R1)
   04650 Natural killer cell mediated cytotoxicity
    101090344 (PPP3R1)
   04660 T cell receptor signaling pathway
    101090344 (PPP3R1)
   04658 Th1 and Th2 cell differentiation
    101090344 (PPP3R1)
   04659 Th17 cell differentiation
    101090344 (PPP3R1)
   04662 B cell receptor signaling pathway
    101090344 (PPP3R1)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    101090344 (PPP3R1)
   04921 Oxytocin signaling pathway
    101090344 (PPP3R1)
   04924 Renin secretion
    101090344 (PPP3R1)
  09156 Nervous system
   04724 Glutamatergic synapse
    101090344 (PPP3R1)
   04720 Long-term potentiation
    101090344 (PPP3R1)
  09158 Development
   04360 Axon guidance
    101090344 (PPP3R1)
   04380 Osteoclast differentiation
    101090344 (PPP3R1)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101090344 (PPP3R1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101090344 (PPP3R1)
   05014 Amyotrophic lateral sclerosis (ALS)
    101090344 (PPP3R1)
  09165 Substance dependence
   05031 Amphetamine addiction
    101090344 (PPP3R1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101090344 (PPP3R1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101090344 (PPP3R1)
   05170 Human immunodeficiency virus 1 infection
    101090344 (PPP3R1)
   05163 Human cytomegalovirus infection
    101090344 (PPP3R1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101090344 (PPP3R1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:fca01009]
    101090344 (PPP3R1)
Protein phosphatases and associated proteins [BR:fca01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     101090344 (PPP3R1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9
Motif
Other DBs
NCBI-GeneID: 101090344
NCBI-ProteinID: XP_019682866
Ensembl: ENSFCAG00000028482
Position
A3
AA seq 164 aa AA seqDB search
MAGAGKQKVDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDG
NGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKD
TQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atggcaggggcaggcaaacaaaaagttgatgctgatgaaattaaaaggctaggaaagaga
tttaagaagctcgatttggacaattctggttctttgagtgtggaagagttcatgtctctg
cctgagttacaacagaatcctttagtacagcgagtaatagatatatttgacacagatggg
aatggagaagtagactttaaagaattcattgagggagtctctcagttcagtgtcaaagga
gataaggaacagaagttgaggtttgctttccgtatctatgacatggataaagatggctat
atttccaacggggaactcttccaggtgctgaagatgatggtggggaacaatctgaaagat
acacagttacagcaaattgtagacaaaaccataataaatgcagataaggatggagatgga
agaatatcctttgaagaattctgtgctgttgtaggtggcctagatatccacaaaaagatg
gtggtagatgtgtga

KEGG   Felis catus (domestic cat): 101093097Help
Entry
101093097         CDS       T02385                                 

Gene name
PPP3CC
Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform isoform X2
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04020  Calcium signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04114  Oocyte meiosis
fca04218  Cellular senescence
fca04310  Wnt signaling pathway
fca04360  Axon guidance
fca04370  VEGF signaling pathway
fca04380  Osteoclast differentiation
fca04625  C-type lectin receptor signaling pathway
fca04650  Natural killer cell mediated cytotoxicity
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04660  T cell receptor signaling pathway
fca04662  B cell receptor signaling pathway
fca04720  Long-term potentiation
fca04724  Glutamatergic synapse
fca04728  Dopaminergic synapse
fca04921  Oxytocin signaling pathway
fca04922  Glucagon signaling pathway
fca04924  Renin secretion
fca05010  Alzheimer disease
fca05014  Amyotrophic lateral sclerosis (ALS)
fca05031  Amphetamine addiction
fca05152  Tuberculosis
fca05163  Human cytomegalovirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05170  Human immunodeficiency virus 1 infection
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101093097 (PPP3CC)
   04310 Wnt signaling pathway
    101093097 (PPP3CC)
   04370 VEGF signaling pathway
    101093097 (PPP3CC)
   04020 Calcium signaling pathway
    101093097 (PPP3CC)
   04022 cGMP-PKG signaling pathway
    101093097 (PPP3CC)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101093097 (PPP3CC)
   04218 Cellular senescence
    101093097 (PPP3CC)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101093097 (PPP3CC)
   04650 Natural killer cell mediated cytotoxicity
    101093097 (PPP3CC)
   04660 T cell receptor signaling pathway
    101093097 (PPP3CC)
   04658 Th1 and Th2 cell differentiation
    101093097 (PPP3CC)
   04659 Th17 cell differentiation
    101093097 (PPP3CC)
   04662 B cell receptor signaling pathway
    101093097 (PPP3CC)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    101093097 (PPP3CC)
   04921 Oxytocin signaling pathway
    101093097 (PPP3CC)
   04924 Renin secretion
    101093097 (PPP3CC)
  09156 Nervous system
   04724 Glutamatergic synapse
    101093097 (PPP3CC)
   04728 Dopaminergic synapse
    101093097 (PPP3CC)
   04720 Long-term potentiation
    101093097 (PPP3CC)
  09158 Development
   04360 Axon guidance
    101093097 (PPP3CC)
   04380 Osteoclast differentiation
    101093097 (PPP3CC)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101093097 (PPP3CC)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101093097 (PPP3CC)
   05014 Amyotrophic lateral sclerosis (ALS)
    101093097 (PPP3CC)
  09165 Substance dependence
   05031 Amphetamine addiction
    101093097 (PPP3CC)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101093097 (PPP3CC)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101093097 (PPP3CC)
   05170 Human immunodeficiency virus 1 infection
    101093097 (PPP3CC)
   05163 Human cytomegalovirus infection
    101093097 (PPP3CC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101093097 (PPP3CC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:fca01009]
    101093097 (PPP3CC)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     101093097 (PPP3CC)
Protein phosphatases and associated proteins [BR:fca01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     101093097 (PPP3CC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Metallophos DUF5378 PTEN_C2
Motif
Other DBs
NCBI-GeneID: 101093097
NCBI-ProteinID: XP_019683998
Ensembl: ENSFCAG00000030895
Position
B1
AA seq 530 aa AA seqDB search
MSGRNFHLSTTERVIKAVPFPPTQRLTLKEVFENGKPKIDVLRNHLVKEGRLEEEVALKI
INDGAAILRQEKTMIELDSPITVCGDIHGQFFDLMKLFEVGGSPTNTRYLFLGDYVDRGY
FSIECVLFLWSLKINHPKTVFLLRGNHECRHLTEYFTFKQECRIKYSEQVYDACMETFDC
LPLAALLNQQFLCVHGGMSPEITSLDDIRKLDRFKEPPAFGPVCDLLWSDPSEDYGSEKT
LEHYTHNTVRGCSYFYSYPAVCEFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLIT
IFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEM
LVNVLNICSDDELISEDEIEDHYISSYRKGGTTVRKEIIKNKIRAIGKMARVFSILREES
ESVLTLKGLTPTGTLPLGVLSGGKQTIETATVEAVEAREAIRGFSLQHRIRSFEEARGLD
RINERMPPRKDSQYPDGPVRLPAQPSAAHRSDRGRRANNDTEPCCGTGYC
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgtctgggaggaacttccacctctccaccaccgaacgcgtcatcaaagctgtccccttt
cctccaacccaacggcttactttgaaggaagtatttgagaatgggaaacctaaaattgat
gtcttaagaaaccatttggtgaaggaagggcgactggaagaggaagtagccttaaagata
atcaatgatggggctgctatcctgagacaagagaagactatgatagaactagattctcca
atcacagtgtgtggtgatattcatggacaattctttgacttgatgaagttgttcgaagtt
ggaggatcacctactaacacacgctacctctttctgggtgactatgtggacagaggctat
ttcagtatagagtgtgtgctgtttttgtggagtttaaagattaatcatcccaaaacagtg
tttctgcttcgaggaaatcatgagtgcaggcatcttacagaatatttcaccttcaaacag
gaatgtcgaatcaaatattctgaacaggtgtatgatgcgtgtatggagacatttgactgt
cttcctcttgctgccctcttaaaccagcagtttctgtgtgtacatggagggatgtcacct
gaaattactagtttagatgacattaggaaattagacaggtttaaagaacctccagccttt
gggccagtgtgtgacctgctttggtctgatccgtcagaggattatggcagtgaaaagacc
ttggagcactatacccacaacactgtccgagggtgctcttatttttacagttaccctgca
gtttgtgaatttttgcagaacaataatttgttatcaataatcagagcccatgaagcccaa
gatgctgggtatcgaatgtacaggaagagccaaacaacaggctttccatcactcattaca
attttctctgcccccaattacctagatgtctataacaataaagctgctgtgttaaaatat
gaaaacaatgtcatgaatatcaggcagtttaactgttctccacacccctactggcttcca
aactttatggatgttttcacatggtctttgccttttgttggggaaaaagtcacagagatg
ctggttaacgttctcaacatatgctctgatgatgaattgatttccgaagatgaaattgaa
gatcactacatttcaagctatcggaaaggaggcactacagttcgaaaggagatcatcaag
aataaaatcagagccattgggaagatggcacgggtcttttcaattctgcgggaagagagt
gagagtgtgctgactctcaagggcctgacgcctacagggacactccctctaggtgtcctc
tcaggaggaaagcagactattgagacagccacagtagaagcggtagaggcccgggaagcc
atcagagggttttcgcttcagcacaggatccggagttttgaagaagcccgaggactggac
cgaattaacgaacggatgccaccccgaaaagacagccagtaccctgacgggccagtgaga
ctgccggcacagcccagcgctgcgcacaggagcgacagggggagaagagccaacaatgac
acagagccctgctgtggcacagggtactgttga

KEGG   Felis catus (domestic cat): 101097144Help
Entry
101097144         CDS       T02385                                 

Gene name
PPP3CA
Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform isoform X1
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04020  Calcium signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04114  Oocyte meiosis
fca04218  Cellular senescence
fca04310  Wnt signaling pathway
fca04360  Axon guidance
fca04370  VEGF signaling pathway
fca04380  Osteoclast differentiation
fca04625  C-type lectin receptor signaling pathway
fca04650  Natural killer cell mediated cytotoxicity
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04660  T cell receptor signaling pathway
fca04662  B cell receptor signaling pathway
fca04720  Long-term potentiation
fca04724  Glutamatergic synapse
fca04728  Dopaminergic synapse
fca04921  Oxytocin signaling pathway
fca04922  Glucagon signaling pathway
fca04924  Renin secretion
fca05010  Alzheimer disease
fca05014  Amyotrophic lateral sclerosis (ALS)
fca05031  Amphetamine addiction
fca05152  Tuberculosis
fca05163  Human cytomegalovirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05170  Human immunodeficiency virus 1 infection
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101097144 (PPP3CA)
   04310 Wnt signaling pathway
    101097144 (PPP3CA)
   04370 VEGF signaling pathway
    101097144 (PPP3CA)
   04020 Calcium signaling pathway
    101097144 (PPP3CA)
   04022 cGMP-PKG signaling pathway
    101097144 (PPP3CA)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101097144 (PPP3CA)
   04218 Cellular senescence
    101097144 (PPP3CA)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101097144 (PPP3CA)
   04650 Natural killer cell mediated cytotoxicity
    101097144 (PPP3CA)
   04660 T cell receptor signaling pathway
    101097144 (PPP3CA)
   04658 Th1 and Th2 cell differentiation
    101097144 (PPP3CA)
   04659 Th17 cell differentiation
    101097144 (PPP3CA)
   04662 B cell receptor signaling pathway
    101097144 (PPP3CA)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    101097144 (PPP3CA)
   04921 Oxytocin signaling pathway
    101097144 (PPP3CA)
   04924 Renin secretion
    101097144 (PPP3CA)
  09156 Nervous system
   04724 Glutamatergic synapse
    101097144 (PPP3CA)
   04728 Dopaminergic synapse
    101097144 (PPP3CA)
   04720 Long-term potentiation
    101097144 (PPP3CA)
  09158 Development
   04360 Axon guidance
    101097144 (PPP3CA)
   04380 Osteoclast differentiation
    101097144 (PPP3CA)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101097144 (PPP3CA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101097144 (PPP3CA)
   05014 Amyotrophic lateral sclerosis (ALS)
    101097144 (PPP3CA)
  09165 Substance dependence
   05031 Amphetamine addiction
    101097144 (PPP3CA)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101097144 (PPP3CA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101097144 (PPP3CA)
   05170 Human immunodeficiency virus 1 infection
    101097144 (PPP3CA)
   05163 Human cytomegalovirus infection
    101097144 (PPP3CA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101097144 (PPP3CA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:fca01009]
    101097144 (PPP3CA)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     101097144 (PPP3CA)
Protein phosphatases and associated proteins [BR:fca01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     101097144 (PPP3CA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Metallophos DUF5378
Motif
Other DBs
NCBI-GeneID: 101097144
NCBI-ProteinID: XP_003985185
Ensembl: ENSFCAG00000022635
UniProt: A0A2I2UWL3
Position
B1
AA seq 521 aa AA seqDB search
MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESV
ALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYV
DRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMD
AFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFG
NEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFP
SLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEK
VTEMLVNVLNICSDDELGSEEDGFDGATAAARKEVIRNKIRAIGKMARVFSVLREESESV
LTLKGLTPTGMLPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRIN
ERMPPRRDAMPSDANLNSINKALASETNGTDSNGSNSSNIQ
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagcccaaggcaattgatcccaagttgtcgacgaccgacagggtggtgaaagct
gtcccatttcctccaagtcaccgacttacagcaaaagaagtattcgataacgatgggaag
cctcgtgtggatatcttaaaggcacatctcatgaaggagggcaggctggaagagagtgtt
gcattgagaataataacagagggggcctcaattcttcgacaggaaaaaaatttgctggat
atcgatgcaccggtcacagtttgtggggacatccatggacaattctttgatttgatgaag
ctttttgaagtggggggatctcctgccaacactcgctacctcttcttaggggactatgtt
gacagagggtacttcagtatcgaatgtgtgctgtatttgtgggccttgaaaattctttac
cccaaaacactgtttttacttcgtggaaatcatgaatgtagacatctaacagagtatttc
acatttaaacaagaatgtaaaataaagtattcagaacgcgtatatgatgcctgtatggat
gcctttgactgcctgcccctggctgccctgatgaaccaacagttcctgtgtgtccacggc
ggtttgtctccagagattaacactttagatgatatcagaaaattagaccgattcaaagaa
ccacctgcttatggacctatgtgtgatatcctgtggtcagaccccctggaggattttgga
aatgagaagactcaggaacatttcactcacaacacagtcagggggtgttcgtacttctac
agctacccggctgtatgtgaattcttacagcacaataacctgttgtctatactccgagcc
catgaagcccaagatgcagggtatcgcatgtacaggaaaagccaaacgacaggcttccct
tctctaattacaattttttcagcaccaaattacttagatgtgtacaataacaaagctgca
gtattgaagtatgagaacaatgtcatgaacatcaggcaattcaactgttctcctcaccca
tactggcttccaaatttcatggatgttttcacttggtccctgccctttgttggagaaaaa
gtgactgaaatgctggtaaatgtcctcaacatctgctcagatgatgaactagggtcagaa
gaagatggatttgatggcgcaacagctgcagcccggaaggaggtgataaggaacaagatc
cgagcaataggcaaaatggcccgagtgttctcagttctcagagaagagagtgagagcgtg
ctaacgctgaaaggcttgactcccacgggcatgctccccagcggagtgctttctggaggg
aagcagaccctgcaaagcgctactgttgaggctattgaggctgatgaagccatcaaagga
ttttcaccacaacataagatcactagcttcgaggaggccaagggcttagaccgaattaac
gagaggatgccacctcgcagagatgccatgccctctgacgccaaccttaactccatcaac
aaggctctcgcctcagagactaacggcacggacagcaatggcagtaatagcagcaatatc
cagtga

KEGG   Felis catus (domestic cat): 101097765Help
Entry
101097765         CDS       T02385                                 

Gene name
PPP3R2
Definition
(RefSeq) calcineurin subunit B type 2
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04020  Calcium signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04114  Oocyte meiosis
fca04218  Cellular senescence
fca04310  Wnt signaling pathway
fca04360  Axon guidance
fca04370  VEGF signaling pathway
fca04380  Osteoclast differentiation
fca04625  C-type lectin receptor signaling pathway
fca04650  Natural killer cell mediated cytotoxicity
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04660  T cell receptor signaling pathway
fca04662  B cell receptor signaling pathway
fca04720  Long-term potentiation
fca04724  Glutamatergic synapse
fca04921  Oxytocin signaling pathway
fca04922  Glucagon signaling pathway
fca04924  Renin secretion
fca05010  Alzheimer disease
fca05014  Amyotrophic lateral sclerosis (ALS)
fca05031  Amphetamine addiction
fca05152  Tuberculosis
fca05163  Human cytomegalovirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05170  Human immunodeficiency virus 1 infection
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101097765 (PPP3R2)
   04310 Wnt signaling pathway
    101097765 (PPP3R2)
   04370 VEGF signaling pathway
    101097765 (PPP3R2)
   04020 Calcium signaling pathway
    101097765 (PPP3R2)
   04022 cGMP-PKG signaling pathway
    101097765 (PPP3R2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101097765 (PPP3R2)
   04218 Cellular senescence
    101097765 (PPP3R2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101097765 (PPP3R2)
   04650 Natural killer cell mediated cytotoxicity
    101097765 (PPP3R2)
   04660 T cell receptor signaling pathway
    101097765 (PPP3R2)
   04658 Th1 and Th2 cell differentiation
    101097765 (PPP3R2)
   04659 Th17 cell differentiation
    101097765 (PPP3R2)
   04662 B cell receptor signaling pathway
    101097765 (PPP3R2)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    101097765 (PPP3R2)
   04921 Oxytocin signaling pathway
    101097765 (PPP3R2)
   04924 Renin secretion
    101097765 (PPP3R2)
  09156 Nervous system
   04724 Glutamatergic synapse
    101097765 (PPP3R2)
   04720 Long-term potentiation
    101097765 (PPP3R2)
  09158 Development
   04360 Axon guidance
    101097765 (PPP3R2)
   04380 Osteoclast differentiation
    101097765 (PPP3R2)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101097765 (PPP3R2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101097765 (PPP3R2)
   05014 Amyotrophic lateral sclerosis (ALS)
    101097765 (PPP3R2)
  09165 Substance dependence
   05031 Amphetamine addiction
    101097765 (PPP3R2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101097765 (PPP3R2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101097765 (PPP3R2)
   05170 Human immunodeficiency virus 1 infection
    101097765 (PPP3R2)
   05163 Human cytomegalovirus infection
    101097765 (PPP3R2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101097765 (PPP3R2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:fca01009]
    101097765 (PPP3R2)
Protein phosphatases and associated proteins [BR:fca01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     101097765 (PPP3R2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 EF-hand_4 SPARC_Ca_bdg EF-hand_9 YtfJ_HI0045
Motif
Other DBs
NCBI-GeneID: 101097765
NCBI-ProteinID: XP_003995756
Position
D4
AA seq 170 aa AA seqDB search
MGNEASYPTEMCSHFNHDEIKRLSKRFKKLDLDCSGSLSVDEFLSLPELRQNPLVQRVID
VFDTDGNGEVDFEEFVVGTSQFSVRGDEEQKLRFAFSIYDMDKDGYISNGELFQVLKMMV
GNNLQDWQLQQIVDKTIIILDRDGDGRISFEEFSAVVGNLEVHKKLVVIV
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatgaagctagttacccgacggagatgtgttcccacttcaaccacgatgaaatt
aaaaggctgagcaagaggtttaagaagctggacttggactgttcgggctctctgagcgtg
gacgagttcttgtccctgcccgagctgcggcagaacccgttggtgcagcgagtgatcgac
gtcttcgacaccgacggcaatggagaggtggactttgaggagttcgtcgtggggacctcc
cagttcagcgtcaggggggacgaggagcagaagttgaggtttgccttcagcatctacgac
atggataaagacggctacatttccaacggggagctgttccaggtgctgaagatgatggtg
gggaacaacctgcaagactggcagttacagcagatcgtggacaaaaccatcatcatcctg
gacagggatggcgacgggagaatatccttcgaggaattcagtgcggtggtcggaaacctg
gaggtccacaagaagttggtggtaattgtgtga

DBGET integrated database retrieval system