KEGG   Felis catus (domestic cat): 101087014Help
Entry
101087014         CDS       T02385                                 

Gene name
CDKN2B
Definition
(RefSeq) cyclin-dependent kinase 4 inhibitor B
  KO
K04685  cyclin-dependent kinase inhibitor 2B
Organism
fca  Felis catus (domestic cat)
Pathway
fca04068  FoxO signaling pathway
fca04110  Cell cycle
fca04218  Cellular senescence
fca04350  TGF-beta signaling pathway
fca04934  Cushing syndrome
fca05166  Human T-cell leukemia virus 1 infection
fca05200  Pathways in cancer
fca05203  Viral carcinogenesis
fca05222  Small cell lung cancer
fca05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    101087014 (CDKN2B)
   04068 FoxO signaling pathway
    101087014 (CDKN2B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101087014 (CDKN2B)
   04218 Cellular senescence
    101087014 (CDKN2B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101087014 (CDKN2B)
   05203 Viral carcinogenesis
    101087014 (CDKN2B)
  09162 Cancer: specific types
   05226 Gastric cancer
    101087014 (CDKN2B)
   05222 Small cell lung cancer
    101087014 (CDKN2B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101087014 (CDKN2B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101087014 (CDKN2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_4 Ank_2 Ank_5 Ank
Motif
Other DBs
NCBI-GeneID: 101087014
NCBI-ProteinID: XP_003995565
Ensembl: ENSFCAG00000015462
UniProt: A0A2I2V3X6
Position
D4
AA seq 138 aa AA seqDB search
MREEDKGMLRGGGDGAGLANASARGQVDTVQQLLEAGADPNGVNRFGRRPIQVMMMGSAR
VAELLLLHGADPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLA
EERGHRDVARYLRAAAGD
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgaggaggacaagggcatgctccgtggtggcggcgacggcgcgggcctggccaac
gcctccgcgcgggggcaagtggacactgtgcagcagctcttggaagccggtgcggatccc
aacggagtcaaccgcttcggaaggcgcccaatccaggtcatgatgatgggcagcgcccgc
gtggccgagctgctgctgctccacggcgcggaccccaactgcgcggatcccgccaccctc
acccgacctgtgcacgacgccgcccgggaggggttcctggacacgctggtggtgctgcac
cgagccggggcgcggctggatgtgcgcgatgcctggggccgcctgcccgtggacctggct
gaggagcggggccaccgcgatgtcgcccggtacctgcgcgcagccgcgggagattga

DBGET integrated database retrieval system