KEGG   Felis catus (domestic cat): 101087070
Entry
101087070         CDS       T02385                                 

Gene name
AKAP5
Definition
(RefSeq) A-kinase anchor protein 5
  KO
K16522  A-kinase anchor protein 5
Organism
fca  Felis catus (domestic cat)
Brite
KEGG Orthology (KO) [BR:fca00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:fca01009]
    101087070 (AKAP5)
Protein phosphatases and associated proteins [BR:fca01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     101087070 (AKAP5)
SSDB
Motif
Pfam: WSK
Other DBs
NCBI-GeneID: 101087070
NCBI-ProteinID: XP_006932971
Ensembl: ENSFCAG00000007817
UniProt: M3X394
Position
B3
AA seq 428 aa
MEATVSEIQVESKDEKRPTEVSPQDERQEEKASVLCFKRRKKAAKEMKPKASSKAAGAAR
TGPPEAGASDQPQAPVGAWASIKRLVRHRKRSEASKQQKPFEAKVQPEISAEDADLSRKK
AKSRLKIPCIKFSKGEKRSNSKIIEDSDCSLRVQGEAERLDTEAPTQSDEQATTPKLPQD
VSKAVSQKGGDEVCEPNGSHSTTAPGEKVIAVELGLDTGHSAIHTGTLVIERDTETTEEK
QSVQPQQASPLEPSETQQQPPLVSDVPPSPAVPDQQIVEEAKSNILESGPNWKQHESGEI
VAEESEPKDTELSQESELRGNEVTAEKPKPEESKRMEPIAIIITDTEISEFDVKKSKNVP
KQFLISIENEQIGVFANDSGFEGRTSEQYETLLKETASSLVKNAIQLSIEQLINEMASDD
NKINNLLQ
NT seq 1287 nt   +upstreamnt  +downstreamnt
atggaagccacagtttctgaaattcaagtcgaaagcaaggatgagaagagaccaacagaa
gtcagtcctcaagatgagcggcaggaggaaaaagcatcagtgctttgcttcaagagaaga
aagaaagcagccaaagagatgaagcccaaagctagctctaaagctgctggtgcagcaaga
acgggtcccccagaggcgggagcttctgatcagccccaggccccagtgggggcctgggcg
tcaatcaaacgtcttgtaaggcacaggaaaaggtcagaagcttcaaagcagcaaaagccc
tttgaggccaaagtgcaacctgaaatcagtgccgaggatgctgatctttctaggaaaaag
gcaaaatccagactcaagattccctgcataaaattctcaaaaggagagaaaagaagtaat
tccaaaattatagaagactccgactgcagcctcagagtccagggagaggccgaacgtttg
gatacggaagctccgacccaatccgatgagcaggcaaccacgcccaagttgccccaggat
gtgagtaaagctgtctcacagaaagggggcgatgaggtctgtgagccaaatgggagccac
agcacaacggcacctggggaaaaagtgattgcagtagaacttgggttagacacggggcat
tctgccattcacacaggaactctagtcattgaacgagatactgaaacaactgaggaaaaa
caaagcgttcaaccccagcaagcaagcccacttgaaccttcagaaacacaacagcaaccc
cctttggtttctgatgttcctccctcacctgcagtcccagatcagcaaattgtggaagaa
gccaaaagcaatatcctagaaagtggaccaaattggaaacagcacgaaagtggagagatt
gttgctgaagagagtgagccaaaagatactgaactgagccaggaatcagagcttagagga
aatgaggtcactgcagagaaaccaaaaccagaagaaagcaaaagaatggagccaattgct
attattattacagacactgaaatcagtgaatttgatgttaagaaatctaaaaatgtccct
aagcaattcttaatttcaattgaaaacgagcaaataggggtttttgctaatgatagtggt
tttgagggtagaacttcagaacaatacgaaacactcttaaaagaaacggcttcttctctt
gtcaagaatgctattcagttgtctatagaacagctgattaatgaaatggcctctgatgat
aataaaataaacaatcttctgcagtga

DBGET integrated database retrieval system