KEGG   Felis catus (domestic cat): 101087179Help
Entry
101087179         CDS       T02385                                 

Gene name
SMAD2
Definition
(RefSeq) mothers against decapentaplegic homolog 2 isoform X1
  KO
K04500  mothers against decapentaplegic homolog 2/3
Organism
fca  Felis catus (domestic cat)
Pathway
fca04068  FoxO signaling pathway
fca04110  Cell cycle
fca04144  Endocytosis
fca04218  Cellular senescence
fca04350  TGF-beta signaling pathway
fca04371  Apelin signaling pathway
fca04390  Hippo signaling pathway
fca04520  Adherens junction
fca04550  Signaling pathways regulating pluripotency of stem cells
fca04659  Th17 cell differentiation
fca04926  Relaxin signaling pathway
fca04933  AGE-RAGE signaling pathway in diabetic complications
fca05142  Chagas disease (American trypanosomiasis)
fca05161  Hepatitis B
fca05166  Human T-cell leukemia virus 1 infection
fca05200  Pathways in cancer
fca05210  Colorectal cancer
fca05212  Pancreatic cancer
fca05225  Hepatocellular carcinoma
fca05226  Gastric cancer
fca05321  Inflammatory bowel disease (IBD)
Module
fca_M00680  TGF-beta signaling
fca_M00681  Activin signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    101087179 (SMAD2)
   04390 Hippo signaling pathway
    101087179 (SMAD2)
   04371 Apelin signaling pathway
    101087179 (SMAD2)
   04068 FoxO signaling pathway
    101087179 (SMAD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101087179 (SMAD2)
  09143 Cell growth and death
   04110 Cell cycle
    101087179 (SMAD2)
   04218 Cellular senescence
    101087179 (SMAD2)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    101087179 (SMAD2)
   04550 Signaling pathways regulating pluripotency of stem cells
    101087179 (SMAD2)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    101087179 (SMAD2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    101087179 (SMAD2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101087179 (SMAD2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101087179 (SMAD2)
   05212 Pancreatic cancer
    101087179 (SMAD2)
   05225 Hepatocellular carcinoma
    101087179 (SMAD2)
   05226 Gastric cancer
    101087179 (SMAD2)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    101087179 (SMAD2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101087179 (SMAD2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101087179 (SMAD2)
   05161 Hepatitis B
    101087179 (SMAD2)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    101087179 (SMAD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MH2 MH1 IRF-3
Motif
Other DBs
NCBI-GeneID: 101087179
NCBI-ProteinID: XP_023097734
Ensembl: ENSFCAG00000013266
Position
D3
AA seq 467 aa AA seqDB search
MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDE
LEKAITTQNCNTKCVTIPSTCSEIWGLSTPNTIDQWDTAGLYSFSEQTRSLDGRLQVSHR
KGLPHVIYCRLWRWPDLHSHHELKAIENCEYAFNLKKDEVCVNPYHYQRVETPVLPPVLV
PRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQS
MDTGSPAELSPTTLSPVNHSLDLQPVTYSEPAFWCSIAYYELNQRVGETFHASQPSLTVD
GFTDPSNSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSP
NCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVK
GWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccatcttgcccttcactccgccagtcgtgaagagactgctgggatggaagaaa
tcagccggtggctctggaggagcgggtggaggagagcagaacggacaagaagaaaagtgg
tgtgagaaagcagttaaaagtttggtgaagaagctaaagaaaacaggacgattagatgag
cttgagaaagccatcaccactcaaaattgtaatactaaatgtgttaccataccaagcact
tgctctgaaatttggggactgagtacaccaaatacgatagatcagtgggatacagcaggc
ctttacagcttctctgaacaaaccaggtctctggatggccgtctgcaagtgtctcatcga
aaaggactgccacatgtgatatattgccgattgtggcgttggcctgaccttcacagtcac
catgaactcaaagccattgaaaactgcgaatatgctttcaatcttaaaaaggatgaagta
tgtgtaaacccttaccactaccagagagttgaaacaccagttttgcctccggtattggtg
ccacggcacaccgagatcctgaccgaactgcctcctctggatgattacacccactccatt
ccagaaaacactaatttcccagcgggaattgagccacagagtaattacatcccagaaacg
ccacctcctggatatatcagtgaggatggagaaacgagtgatcaacagttgaaccaaagt
atggatacaggatctccagcagaactgtctcctactactctttcccctgttaatcatagt
ttggatttgcagccagttacttactcagaacctgcattttggtgttcaatagcatattat
gaattaaaccagagggttggagagaccttccacgcatcacagccctcactcactgtagac
ggtttcacagatccatccaattcagagaggttctgcctagggttgctctccaacgtcaac
cgaaatgccaccgtagaaatgacaagaagacatataggaagaggagtacgcttatattac
ataggtggagaagtttttgcagagtgcctaagcgatagtgcaatctttgtgcagagcccc
aactgtaatcagagatacggctggcacccggcaacagtgtgtaaaatcccaccaggctgt
aatctgaagatcttcaacaaccaggaatttgctgctcttctggctcagtctgtcaatcag
ggttttgaagccgtgtatcaactaactagaatgtgcaccataagaatgagttttgtgaaa
gggtggggagcagaataccgaaggcagacggtaacaagcactccttgctggatcgaactt
catctgaatgggcctctgcagtggttggacaaagtgttaactcagatgggatccccttca
gtgcgttgttcaagcatgtcctaa

KEGG   Felis catus (domestic cat): 101101387Help
Entry
101101387         CDS       T02385                                 

Gene name
SMAD3
Definition
(RefSeq) mothers against decapentaplegic homolog 3
  KO
K04500  mothers against decapentaplegic homolog 2/3
Organism
fca  Felis catus (domestic cat)
Pathway
fca04068  FoxO signaling pathway
fca04110  Cell cycle
fca04144  Endocytosis
fca04218  Cellular senescence
fca04350  TGF-beta signaling pathway
fca04371  Apelin signaling pathway
fca04390  Hippo signaling pathway
fca04520  Adherens junction
fca04550  Signaling pathways regulating pluripotency of stem cells
fca04659  Th17 cell differentiation
fca04926  Relaxin signaling pathway
fca04933  AGE-RAGE signaling pathway in diabetic complications
fca05142  Chagas disease (American trypanosomiasis)
fca05161  Hepatitis B
fca05166  Human T-cell leukemia virus 1 infection
fca05200  Pathways in cancer
fca05210  Colorectal cancer
fca05212  Pancreatic cancer
fca05225  Hepatocellular carcinoma
fca05226  Gastric cancer
fca05321  Inflammatory bowel disease (IBD)
Module
fca_M00680  TGF-beta signaling
fca_M00681  Activin signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    101101387 (SMAD3)
   04390 Hippo signaling pathway
    101101387 (SMAD3)
   04371 Apelin signaling pathway
    101101387 (SMAD3)
   04068 FoxO signaling pathway
    101101387 (SMAD3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101101387 (SMAD3)
  09143 Cell growth and death
   04110 Cell cycle
    101101387 (SMAD3)
   04218 Cellular senescence
    101101387 (SMAD3)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    101101387 (SMAD3)
   04550 Signaling pathways regulating pluripotency of stem cells
    101101387 (SMAD3)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    101101387 (SMAD3)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    101101387 (SMAD3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101101387 (SMAD3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101101387 (SMAD3)
   05212 Pancreatic cancer
    101101387 (SMAD3)
   05225 Hepatocellular carcinoma
    101101387 (SMAD3)
   05226 Gastric cancer
    101101387 (SMAD3)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    101101387 (SMAD3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101101387 (SMAD3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101101387 (SMAD3)
   05161 Hepatitis B
    101101387 (SMAD3)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    101101387 (SMAD3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MH2 MH1 IRF-3
Motif
Other DBs
NCBI-GeneID: 101101387
NCBI-ProteinID: XP_023110921
Ensembl: ENSFCAG00000027081
Position
B3
AA seq 425 aa AA seqDB search
MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNV
NTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEV
CVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETP
PPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYEL
NQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIG
GEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGF
EAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIR
CSSVS
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccatcctgcccttcacccccccgatcgtgaagcgcctgctgggctggaagaag
ggcgagcagaacgggcaggaggagaagtggtgcgagaaggcggtcaagagtttggtcaag
aagctcaagaagaccgggcagctggacgaactggagaaggccatcaccacgcagaacgtc
aacaccaagtgcatcaccatccccaggtccctggatggccgactgcaggtgtcccatcgg
aaggggctcccccatgtcatctactgccgcctgtggcgatggcctgacctccacagccac
cacgagctgcgggccatggagctatgcgagttcgccttcaacatgaagaaggacgaggtc
tgcgtgaatccctaccactatcagagggtagagaccccagttctacctcctgtgctggtg
ccacgccacacagagatcccggccgagttccccccgctggacgactacagccattccatc
cccgagaacactaacttccccgcgggcatcgagccccagagcaatattccagaaacccca
ccccctggctacctgagtgaagatggagagaccagtgaccaccagatgaaccacagcatg
gatgcaggttctccaaacctatccccgaatccgatgtccccagcacacaacaatttggac
ctgcagcctgtcacctactgcgagccagccttctggtgctccatttcctactacgagctg
aaccagcgcgtcggggagaccttccacgcctcccagccctccatgaccgtggacggcttc
accgacccctccaactcggagcgcttctgcctggggctgctctccaatgtcaacaggaac
gcggctgtggagctcacacggaggcatatcgggcgaggcgtgcggctgtactacatcgga
ggggaggtcttcgccgagtgcctcagtgacagcgccatctttgtccagtctcccaactgt
aaccagcgctacggctggcacccggccaccgtctgcaagatcccgccaggatgcaacctg
aagatcttcaacaaccaggagtttgccgccctcctggctcagtctgtcaaccagggcttc
gaggcggtctaccagctgacccggatgtgcaccatccgcatgagcttcgtcaaaggctgg
ggagcagagtacaggagacagacagtgaccagcactccctgctggattgagctgcacctg
aatgggccgttgcagtggcttgacaaggtcctcacccagatgggctccccaagcatccgc
tgttccagtgtgtcttag

DBGET integrated database retrieval system