KEGG   Felis catus (domestic cat): 101087257Help
Entry
101087257         CDS       T02385                                 

Gene name
IRS1
Definition
(RefSeq) insulin receptor substrate 1
  KO
K16172  insulin receptor substrate 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04022  cGMP-PKG signaling pathway
fca04068  FoxO signaling pathway
fca04140  Autophagy - animal
fca04150  mTOR signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04152  AMPK signaling pathway
fca04211  Longevity regulating pathway
fca04213  Longevity regulating pathway - multiple species
fca04722  Neurotrophin signaling pathway
fca04910  Insulin signaling pathway
fca04920  Adipocytokine signaling pathway
fca04923  Regulation of lipolysis in adipocytes
fca04930  Type II diabetes mellitus
fca04931  Insulin resistance
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca04960  Aldosterone-regulated sodium reabsorption
fca05206  MicroRNAs in cancer
SSDB OrthologParalogGFIT
Motif
Pfam: IRS PH PH_11
Motif
Other DBs
NCBI-GeneID: 101087257
NCBI-ProteinID: XP_003991268
Ensembl: ENSFCAG00000003009
UniProt: M3WUW8
Position
C1
AA seq 1234 aa AA seqDB search
MASPPETEGFSDVRKVGYLRKPKSMHKRFFVLRAASEAGGPARLEYYENEKKWRHKSSAP
KRSIPLESCFNINKRADSKNKHLVALYTRDEHFAIAADSEAEQDSWYQALLQLHNRAKSH
HDGAAAPGAGGGGGSCSGSSGLGEAGEDLSYGDVPPGPAFKEVWQVILKPKGLGQTKNLI
GIYRLCLTSKTISFVKLNSEAAAVVLQLMNIRRCGHSENFFFIEVGRSAVTGPGEFWMQV
DDSVVAQNMHETILEAMRAMSDEFRPRSKSQSSSNCSNPISVPLRRHHLNNPPPSQVGLT
RRSRTESITATSPASMVGGKQGSFRVRASSDGEGTMSRPASVDGSPVSPSTNRTHAHRHR
GSSRLHPPLNHSRSIPMPSSRCSPSATSPVSLSSSSTSGHGSTSDCLFPRRSSASVSGSP
SDGGFISSDEYGSSPCDFRSSFRSVTPDSLGHTPPARGEEELSNYICMGGKGSSTLTAPN
GHYILPRGGNGHRYVAGAGLGTSPALAGDEGASAADLDNRFRKRTHSAGTSPTISHQKTP
SQSSVASIEEYTEMMPAYPPGGGSGGRLPGYRHSAFVPTHSYPEEGLEVHRGHHRPDTSS
LHTDDGYMPMSPGVAPVPSSRKGSGDYMPMSPKSVSAPQQIINPIRRHPQRVDPNGYMMM
SPSGSCSPDIGGGPSSSGSGAAPSGSSYGKLWTNGVGGHHPHALPHPKLPVESGGGKLLS
CTGDYINMSPVGDSNTSSPSDCYYGQEDPQHKPVLSYYSLPRSFKHTQRPGELEESARHQ
HLRLSSSSGRLLYATTAEDSSSSTSSDSLGGGYCGVRPDSGLPHIHHQVLQPHLPRKVDT
AAQTNSRLARPTRLSLGDPKASTLPRVREQQPQPPLLHPPEPKSPGEYVNIEFGGDQPGY
LSGPVASRGSPSVRCPSQLQPAPREEETGTEEYMNMDLGPGRRATWQEGAGGQPGRVGPT
PPGAASVCRPTRAVPSSRGHYMTMQMGCPGQSYVDTSPVAPISYADMRTGLVAEEASLPG
TTAAAPSSSSAASASPTAPQKAGELVARSSLLGGPQGPGGMSAFTRVNLSPNRNQSAKVI
RADPQGCRRRHSSETFSSTPSATRAGNTVPFGGGAAGGGSGGGNGSAEEVKRHSSASFEN
VWLRPGELGGAPKELAQVCGAAGGLENGLNYIDLDLVKDFKQRPQERPPQPQPPPPPPPH
QPLGSSEGSSTRRSSEDLSAYASISFQKQPEDLQ
NT seq 3705 nt NT seq  +upstreamnt  +downstreamnt
atggcgagccctccggagaccgaaggcttctcggacgtgcgcaaggtgggctacctgcgc
aaacccaagagcatgcacaagcgcttcttcgtgctgcgggcggccagcgaggcggggggc
ccggcgcgcctcgagtactacgagaacgagaagaagtggcggcacaagtcgagcgccccc
aaacgctcgatccccctggagagctgcttcaacatcaacaagcgggcggactccaagaac
aagcacctggtggccctctacacccgggacgagcactttgccatcgcggcggacagcgag
gcggagcaggacagctggtaccaggccctcctgcagctgcacaaccgggccaagagccac
cacgacggggccgcggcccccggggcaggaggcggcgggggcagctgcagtggcagctcg
ggcctcggcgaggctggggaggacttgagctacggggatgtgcccccaggacctgcgttc
aaggaggtctggcaggtgatcctgaaacccaagggcctgggtcagacaaagaacctgatt
ggcatctaccgtctctgcctgaccagcaagaccatcagcttcgtgaagctgaactcggag
gcggcggccgtggtgctgcagctgatgaacatcagacgctgcggccactccgagaacttc
ttcttcatcgaagtgggccgttccgcggtgacgggacctggggagttctggatgcaggtg
gatgactctgtggtggcccagaacatgcacgagacaatcctggaggccatgcgggccatg
agcgacgagttccgtcctcgaagtaagagccagtcctcttccaactgctccaaccccatc
agcgtcccgctgcgcaggcaccacctcaacaacccgccacccagccaggtggggctgacc
cgccgctctcgcaccgagagcatcaccgccacctctccggccagcatggtgggcgggaag
cagggctccttccgcgtgcgcgcgtccagcgacggcgagggcaccatgtcccgcccggcc
tcggtggacggcagccccgtgagtcctagcaccaacaggacgcacgcgcaccggcatcgc
ggcagctcccggctgcacccgcctctcaaccacagccgctccatccccatgccttcgtcc
cgctgctcgccttctgccaccagcccggtcagtctgtcgtccagcagcaccagtggccac
ggctccacctcggactgcctcttcccccggcgctctagtgcttctgtgtccggttccccc
agcgatggcggtttcatctcctcggacgagtacggctccagtccttgcgatttccgaagt
tccttccgcagtgtcaccccggattccctgggccacaccccaccggcccgcggggaggag
gagctgagcaactacatctgcatgggaggcaaaggatcctccaccctcaccgcccccaat
ggtcactacattttgcctcggggtggcaatggtcaccgctacgtcgccggggccggcctg
ggcaccagcccagccctggccggggatgaaggagctagtgcagccgatctggataatcgg
ttccgaaagcggactcactcggccggcacgtcccctaccatttcccaccagaagacccca
tcgcagtcctcggtagcttccattgaggagtacacggagatgatgcctgcctacccgcca
ggaggtggcagcggaggccgcctgcccggctaccggcactccgccttcgtgcccacccac
tcctaccccgaggagggtctggaggtgcaccggggccaccaccgcccagacacctcctct
ctccacactgatgatggctacatgcccatgtccccaggagtggccccagtgcccagcagc
cgcaagggcagcggggactacatgcccatgagccccaagagcgtgtctgcgccacagcag
atcatcaaccccatcaggcgccatccccagagggtggatcccaatggctacatgatgatg
tcccctagcggcagctgctctcctgacatcggaggtgggcccagcagcagcggcagcggc
gccgccccctctgggagcagctacgggaagctgtggaccaacggggtcgggggccaccac
cctcacgctctgccacatcccaaactccccgtagagagtggtggcggcaagctcttgtct
tgtactggtgactacataaatatgtcgccggtgggggactccaataccagcagcccctcc
gactgctactatggccaggaggacccccagcacaagccagtcctctcctactactcgttg
ccaaggtcctttaagcacacccagcgccccggggagctggaggagagtgcccggcaccag
cacctccgcctttcctccagctctggtcgccttctctatgccaccaccgcagaagattcc
tcctcctctaccagcagcgacagcctgggcggcgggtactgtggggtcaggcccgattct
ggcctcccgcacatccaccatcaggtcctgcagccccatctgcctcgaaaggtggacaca
gctgcccagaccaacagccgcctggctcggcccacgaggctgtccctgggggatcccaag
gccagcaccttacctcgggtccgagagcagcagccacagcccccgctgctgcaccctccg
gagcccaagagcccaggggaatatgtgaatattgagtttgggggggatcagccgggctac
ttatctggtcccgtggcttcccgcggctcgccttctgtcaggtgcccatcccagctccag
ccagcccccagggaggaagagactggcactgaagagtacatgaacatggacctggggcca
ggcaggagggccacctggcaggagggtgccggcggccagccaggcagagtgggccccaca
cctcctggggcggccagcgtgtgcaggcccacccgggccgtgcccagcagccgcggtcac
tacatgaccatgcagatgggctgtcccggtcagagctatgtggacacctcaccagttgcc
cccatcagctatgctgacatgcggacaggcctcgttgcggaggaggcgagccttccgggg
accacggccgccgctccctcctcatcctcggcggcctcggcttcccccactgcgcctcaa
aaagcaggggagctggtggcccgctcttccctgctggggggcccgcagggacccggaggc
atgagcgccttcaccagggtgaacctcagccccaaccggaaccagagtgccaaagtgatc
cgtgcggacccgcaagggtgccggaggcggcacagctctgagaccttctcctcgacaccc
agtgccacccgggcgggcaacacggtgcccttcggagggggcgctgcaggagggggcagc
ggtggtggcaacggcagcgccgaggaggtgaaacgccacagttctgcttccttcgagaac
gtgtggctgaggcctggggagctcgggggagcccccaaggagctggcccaagtgtgcggg
gccgccgggggtttggagaacgggcttaactacatagacctggatttggtcaaggacttc
aaacagcgccctcaggagcgcccccctcaaccacagccgccccctcccccgccccctcat
cagcctctgggcagcagcgagggcagctccacccgccgctccagcgaggatttaagcgcc
tatgccagcatcagtttccagaagcagccagaggacctccagtag

DBGET integrated database retrieval system