KEGG   Felis catus (domestic cat): 101087400Help
Entry
101087400         CDS       T02385                                 

Gene name
ETNPPL
Definition
(RefSeq) ethanolamine-phosphate phospho-lyase isoform X1
  KO
K14286  ethanolamine-phosphate phospho-lyase [EC:4.2.3.2]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00564  Glycerophospholipid metabolism
fca01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    101087400 (ETNPPL)
Enzymes [BR:fca01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.2  ethanolamine-phosphate phospho-lyase
     101087400 (ETNPPL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-GeneID: 101087400
NCBI-ProteinID: XP_003985145
Ensembl: ENSFCAG00000002319
Position
B1
AA seq 547 aa AA seqDB search
MPPVTPDAPGEGTPRGTAAGKARRWGSLARQALAGERESRGAPGSRATMCELYSKQDTLA
LRRKHIGPSCKVFFAADPIKIVRAQGQYMFDERGEQYLDCINNVAHVGHCHPEVVTAALK
QMELLNTNSRFLHDNIVEYARRLSATLPETLSVCYFTNSGSEANDLALRLARQFRGHQDV
ITLDHAYHGHLSSLIEISPYKFRKGKDVKKEFVHVAPTPDTYRGKYREDHADPAGAYADE
VKKIIEEAHNSGRKIAAFIAESMQSCGGQIIPPAGYFQKVAEYVHRAGGVFIADEVQVGF
GRVGKHFWSFQMHGEDFVPDIVTMGKPMGNGHPMACVVTTKEIAEAFSSSGMEYFNTYGG
NPVSSAIGLAVLNVIESEDLQGNATRVGDYLTELLNKQKAKHTLIGDIRGIGLFIGIDLV
KDQQKRTPATDEAQHVIYKMKEKQVLLSADGPHRNVLKIKPPMCFTEEDAKFMVDQLDEI
LTVVEEAIGAKSESVTSENTPCRTKMPNEAHSELLSEGTSDPRENPSRKRNGLCTDKHSL
LSKRLKT
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgccaccagtgactccagacgccccgggcgaggggaccccacgagggaccgcggcggga
aaggcccgccgctggggcagcctcgcgaggcaggcgctcgcaggcgagagggagagccga
ggagcgcccggcagccgcgccaccatgtgcgagctgtacagcaagcaggacaccctggcg
ctgaggaggaagcacatcgggccctcatgcaaagtgttctttgctgcggatcccatcaaa
atagtgcgagcccaggggcagtacatgtttgacgagagaggtgaacagtacctggactgc
atcaacaacgtggcgcacgtgggacactgtcacccggaagtggtcacggctgccctgaaa
cagatggaactgctaaacacaaattctcgattccttcatgacaatattgttgagtatgcc
aggcgcctttcagcaaccctgccggagacgctctctgtttgctattttacaaactcagga
tctgaagccaatgacttagccttacgcttggctcggcagttcagaggccaccaagatgtg
atcactcttgaccatgcttaccatggtcacctatcatctttaattgagatcagtccatac
aaattccgaaagggcaaagatgtcaagaaagaatttgtgcatgtggcaccaactccagat
acttacagaggaaaatacagagaagatcatgcagacccagccggcgcttatgcagatgaa
gtgaagaaaattattgaagaagctcataacagtggaaggaagattgctgcctttattgct
gaatccatgcagagttgtggcggacaaataattcctccagcaggctacttccagaaagtg
gcagaatatgtacacagagcaggaggtgtgtttatagctgatgaagttcaggtgggcttt
ggccgagttggaaaacatttctggagcttccaaatgcatggtgaagattttgttccagat
attgtcacgatggggaaaccaatgggcaatggccacccaatggcatgcgttgtaacaacc
aaagaaattgcagaggccttcagcagttctgggatggaatacttcaatacgtatggagga
aatccagtatcttctgctattggtttggctgtcctgaatgtaattgaaagtgaagacctt
caaggaaatgccacgagagtgggggattatcttactgaattactcaataaacagaaggct
aaacatactttaataggagatatcaggggcattggcctgtttattggaattgacttggtg
aaagaccagcagaaaaggacccctgccacagatgaggctcaacatgtcatctacaagatg
aaagaaaagcaagtgcttctcagtgccgacggacctcatagaaatgtgcttaaaataaaa
ccacctatgtgcttcactgaagaagatgccaagtttatggtggaccaactcgatgagatt
ctaacagttgtggaagaagccatcggagccaaaagtgagagtgtgacctctgagaatact
ccatgcagaacaaagatgcctaacgaagcacactcggaattgctcagtgaaggcacctcg
gatcccagagaaaatcccagccgaaagagaaatggattgtgcacagataagcactcgctg
ctcagtaagaggctcaagacatga

DBGET integrated database retrieval system