KEGG   Felis catus (domestic cat): 101087422Help
Entry
101087422         CDS       T02385                                 

Gene name
HSPA8
Definition
(RefSeq) heat shock cognate 71 kDa protein
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
fca  Felis catus (domestic cat)
Pathway
fca03040  Spliceosome
fca04010  MAPK signaling pathway
fca04141  Protein processing in endoplasmic reticulum
fca04144  Endocytosis
fca04213  Longevity regulating pathway - multiple species
fca04612  Antigen processing and presentation
fca04915  Estrogen signaling pathway
fca05134  Legionellosis
fca05145  Toxoplasmosis
fca05162  Measles
Module
fca_M00353  Spliceosome, Prp19/CDC5L complex
fca_M00355  Spliceosome, 35S U5-snRNP
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    101087422 (HSPA8)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101087422 (HSPA8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101087422 (HSPA8)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101087422 (HSPA8)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    101087422 (HSPA8)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    101087422 (HSPA8)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    101087422 (HSPA8)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    101087422 (HSPA8)
  09172 Infectious disease: viral
   05162 Measles
    101087422 (HSPA8)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101087422 (HSPA8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:fca01009]
    101087422 (HSPA8)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:fca03041]
    101087422 (HSPA8)
   03009 Ribosome biogenesis [BR:fca03009]
    101087422 (HSPA8)
   03110 Chaperones and folding catalysts [BR:fca03110]
    101087422 (HSPA8)
   04131 Membrane trafficking [BR:fca04131]
    101087422 (HSPA8)
   03051 Proteasome [BR:fca03051]
    101087422 (HSPA8)
   03029 Mitochondrial biogenesis [BR:fca03029]
    101087422 (HSPA8)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101087422 (HSPA8)
Protein phosphatases and associated proteins [BR:fca01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     101087422 (HSPA8)
Spliceosome [BR:fca03041]
 Complex B
  Other components
   Prp19 complex
    101087422 (HSPA8)
 Complex C
   Prp19-CDC5 complex
    101087422 (HSPA8)
Ribosome biogenesis [BR:fca03009]
 Eukaryotic Type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    101087422 (HSPA8)
Chaperones and folding catalysts [BR:fca03110]
 Heat shock proteins
  HSP70 / DNAK
   101087422 (HSPA8)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    101087422 (HSPA8)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    101087422 (HSPA8)
Proteasome [BR:fca03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    101087422 (HSPA8)
Mitochondrial biogenesis [BR:fca03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    101087422 (HSPA8)
Exosome [BR:fca04147]
 Exosomal proteins
  Proteins found in most exosomes
   101087422 (HSPA8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C DDR HORMA MetOD2
Motif
Other DBs
NCBI-GeneID: 101087422
NCBI-ProteinID: XP_003992527
Ensembl: ENSFCAG00000001132
UniProt: A0A2I2UZM2
Position
D1
AA seq 646 aa AA seqDB search
MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
MNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVS
SMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAA
IAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNH
FIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRA
RFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELN
KSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTI
PTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDI
DANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKN
SLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELE
KVCNPIITKLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgtctaagggacctgcagttggcattgatcttggcaccacctactcctgtgtgggtgtt
ttccagcacgggaaagtggaaataattgccaacgatcagggaaaccgaaccactccaagt
tatgtcgcctttactgacaccgaacgattgatcggtgatgctgcaaagaatcaagttgca
atgaaccccaccaacacagtttttgatgccaaacgcctgattggacgtagattcgacgac
gctgttgtccaatctgatatgaagcattggcccttcatggtggtgaatgatgctggcagg
cccaaggtccaagtagaatacaagggagagaccaaaagtttctatccagaggaggtatct
tctatggttttgacaaagatgaaggaaatcgcagaggcttaccttgggaagactgttact
aatgctgtagtcacagtacctgcctattttaacgattctcagcgtcaggctaccaaagat
gctggaactattgctggtcttaatgtactgcgaatcatcaatgagccaacagctgctgct
atcgcttatggcttagacaaaaaggttggggccgagaggaatgtgctgatctttgacttg
ggaggtggcacttttgatgtgtcaatcctcactattgaagacgggatctttgaggtcaaa
tctactgctggagacactcacttaggtggagaagactttgacaaccgaatggtaaaccat
tttattgcggagttcaagcgcaaacacaagaaggacatcagcgagaacaagagagcagtc
cgtcgcctccgtaccgcttgcgagcgcgccaagcgtacgctttcttccagcacccaggcc
agtattgagattgattctctgtatgaaggaatcgacttctatacctctattactcgtgcc
cggtttgaagaattaaacgctgacctgttccgtggcacgctggaccctgtagagaaagcc
cttcgggatgccaagctagacaagtctcagatccacgatattgtcttggtgggtggctct
acgcgtatccccaagattcagaaacttctacaagactttttcaacgggaaggaactgaat
aagagcatcaaccctgatgaggctgttgcttatggtgcagctgtgcaggcagccatcctt
tctggagacaaatccgaaaatgttcaagatttgctgctgttggatgtcactcccctttct
ctcggcattgaaaccgccggtggagtcatgactgttctcatcaagcgcaatactaccatt
cctaccaaacagacccaaaccttcactacctactctgacaaccagcctggtgtgctcatt
caggtttatgaaggtgagcgtgccatgaccaaggataacaacctactgggcaagtttgaa
ctcacaggcatacctcctgccccccgtggcgttcctcagatcgaggtcacctttgatatt
gatgctaatggcattctcaatgtctctgctgtggataagagcacaggaaaagagaataag
atcaccatcacaaatgacaaaggtcgcttgagcaaggaagacattgagcgcatggtccag
gaagctgagaagtacaaagctgaagatgagaagcagcgagacaaggtgtcctccaagaat
tcccttgaatcttatgcgttcaacatgaaagcaactgttgaagatgaaaagcttcagggt
aaaatcaacgatgaggacaaacagaagattctggacaagtgtaatgagatcatcaactgg
ctggataagaaccagactgcagaaaaagaagaattcgaacatcagcagaaagagctggag
aaggtctgcaatcccatcattacgaagctgtaccagagtgcaggaggcatgcctggagga
atgcctggaggcttccctggtggtggagctcccccctctggtggtgcctcctctgggccc
accattgaagaggttgattaa

KEGG   Felis catus (domestic cat): 101088003Help
Entry
101088003         CDS       T02385                                 

Gene name
HSPA2
Definition
(RefSeq) heat shock-related 70 kDa protein 2
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
fca  Felis catus (domestic cat)
Pathway
fca03040  Spliceosome
fca04010  MAPK signaling pathway
fca04141  Protein processing in endoplasmic reticulum
fca04144  Endocytosis
fca04213  Longevity regulating pathway - multiple species
fca04612  Antigen processing and presentation
fca04915  Estrogen signaling pathway
fca05134  Legionellosis
fca05145  Toxoplasmosis
fca05162  Measles
Module
fca_M00353  Spliceosome, Prp19/CDC5L complex
fca_M00355  Spliceosome, 35S U5-snRNP
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    101088003 (HSPA2)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101088003 (HSPA2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101088003 (HSPA2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101088003 (HSPA2)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    101088003 (HSPA2)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    101088003 (HSPA2)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    101088003 (HSPA2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    101088003 (HSPA2)
  09172 Infectious disease: viral
   05162 Measles
    101088003 (HSPA2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101088003 (HSPA2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:fca01009]
    101088003 (HSPA2)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:fca03041]
    101088003 (HSPA2)
   03009 Ribosome biogenesis [BR:fca03009]
    101088003 (HSPA2)
   03110 Chaperones and folding catalysts [BR:fca03110]
    101088003 (HSPA2)
   04131 Membrane trafficking [BR:fca04131]
    101088003 (HSPA2)
   03051 Proteasome [BR:fca03051]
    101088003 (HSPA2)
   03029 Mitochondrial biogenesis [BR:fca03029]
    101088003 (HSPA2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101088003 (HSPA2)
Protein phosphatases and associated proteins [BR:fca01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     101088003 (HSPA2)
Spliceosome [BR:fca03041]
 Complex B
  Other components
   Prp19 complex
    101088003 (HSPA2)
 Complex C
   Prp19-CDC5 complex
    101088003 (HSPA2)
Ribosome biogenesis [BR:fca03009]
 Eukaryotic Type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    101088003 (HSPA2)
Chaperones and folding catalysts [BR:fca03110]
 Heat shock proteins
  HSP70 / DNAK
   101088003 (HSPA2)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    101088003 (HSPA2)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    101088003 (HSPA2)
Proteasome [BR:fca03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    101088003 (HSPA2)
Mitochondrial biogenesis [BR:fca03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    101088003 (HSPA2)
Exosome [BR:fca04147]
 Exosomal proteins
  Proteins found in most exosomes
   101088003 (HSPA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C DUF1464 DDR CRIC_ras_sig Zincin_2
Motif
Other DBs
NCBI-GeneID: 101088003
NCBI-ProteinID: XP_006932972
Ensembl: ENSFCAG00000007820
UniProt: M3W8G1
Position
B3
AA seq 639 aa AA seqDB search
MSARGPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV
AMNPTNTIFDAKRLIGRKFEDSTVQSDMKHWPFRVVSEGGKPKVQVEYKGEIKTFFPEEI
SSMVLTKMKEIAEAYLGGKVQSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAA
AIAYGLDKKGCAGGEKNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRM
VSHLAEEFKRKHKKDIGPNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSI
TRARFEELNADLFRGTLEPVEKALRDAKLDKGQIQEIVLVGGSTRIPKIQKLLQDFFNGK
ELNKSINPDEAVAYGAAVQAAILIGDKSENVQDLLLLDVTPLSLGIETAGGVMTPLIKRN
TTIPTKQTQTFTTYSDNQSSVLVQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVT
FDIDANGILNVTAADKSTGKENKITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVA
AKNAVESYTYNIKQTVEDEKLRGKISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHKQK
ELERVCNPIISKLYQGGPGGGGSGGGSGASGGPTIEEVD
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcccgcggcccggctatcggcatcgacctgggcaccacctactcgtgcgtgggg
gtcttccaacatggcaaggtggagatcatcgccaacgaccagggcaaccgcaccaccccc
agctacgtggccttcaccgacaccgagcgcctcatcggcgacgccgccaagaaccaggtg
gccatgaatcccaccaacaccatcttcgacgccaagaggctgatcggacggaagttcgag
gactccacggtgcagtcggacatgaaacattggccgttcagggtggtgagcgagggagga
aagcccaaagtgcaggtggagtacaagggagagatcaagaccttcttcccggaggagatc
tcctccatggtcctcactaagatgaaggagatcgccgaagcctacctgggaggcaaggtg
cagagcgcggtcatcacggtcccggcctatttcaatgactcgcagcgccaggccaccaag
gacgcgggcaccatcacgggcctcaacgtgctgcgcatcattaacgagcccaccgcggcg
gccattgcctacggcctggacaagaagggctgcgccggcggcgagaagaacgtgctcatc
tttgacctgggcggcggcaccttcgacgtgtccatcctgaccatcgaggacggcatcttc
gaagtgaagtccacggccggcgacacccacctgggcggcgaggacttcgacaaccgcatg
gtgagccacctggcggaggagttcaagcgcaagcacaagaaggacattgggcccaacaag
cgcgctgtgcggcggctgcgtaccgcctgcgagcgcgccaagcgcaccttgagctcgtct
acgcaggcgagcattgagatcgactcgctgtacgagggcgtggacttctacacgtccatc
acccgcgcccgcttcgaggagctcaacgctgacctgttccgcggaaccctggagccagtg
gagaaggcgctgcgtgacgccaagctagacaaaggccagatccaggagatcgtgctggtg
ggcggctccacccgcatccccaagatccagaagctgctgcaggatttcttcaacggcaag
gagctgaacaagagcatcaaccccgacgaggcggtggcctacggggccgcggtgcaggcg
gccattctcatcggggacaagtcagagaacgtgcaggacctcctgctgctcgacgtgacc
ccgttgtcgctgggcattgagacggctggcggcgtcatgaccccgctcatcaagagaaac
accacgatccctaccaagcagacgcagaccttcaccacctactctgacaaccagagcagc
gtgctggtgcaggtgtacgagggcgaacgggccatgaccaaggacaataacctgctgggc
aagttcgacctgaccgggattccccctgcgccccgcggggtcccccagatcgaggtaacc
ttcgacatcgacgccaacggcatcctcaacgtcaccgccgctgacaagagcaccggtaaa
gaaaacaaaatcaccataaccaacgacaagggtcgtctgagcaaggacgacattgaccgg
atggtgcaggaagcggagcggtacaagtcggaagatgaggccaatcgtgaccgggtcgcc
gccaaaaatgcggtagagtcctatacctacaacatcaagcagacggtggaagacgagaaa
ctgaggggcaagattagcgagcaggacaaaaacaagatcctcgacaagtgccaggaggtg
atcaactggctcgacagaaaccagatggcggagaaagatgagtatgaacacaagcagaaa
gagctcgaaagagtgtgcaaccccatcatcagcaaactttaccaaggcggtcctggcggc
ggcggcagcggcggcggttctggagcctccgggggaccgaccatcgaggaagtggactaa

KEGG   Felis catus (domestic cat): 101091022Help
Entry
101091022         CDS       T02385                                 

Definition
(RefSeq) heat shock 70 kDa protein 1-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
fca  Felis catus (domestic cat)
Pathway
fca03040  Spliceosome
fca04010  MAPK signaling pathway
fca04141  Protein processing in endoplasmic reticulum
fca04144  Endocytosis
fca04213  Longevity regulating pathway - multiple species
fca04612  Antigen processing and presentation
fca04915  Estrogen signaling pathway
fca05134  Legionellosis
fca05145  Toxoplasmosis
fca05162  Measles
Module
fca_M00353  Spliceosome, Prp19/CDC5L complex
fca_M00355  Spliceosome, 35S U5-snRNP
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    101091022
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101091022
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101091022
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101091022
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    101091022
  09152 Endocrine system
   04915 Estrogen signaling pathway
    101091022
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    101091022
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    101091022
  09172 Infectious disease: viral
   05162 Measles
    101091022
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101091022
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:fca01009]
    101091022
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:fca03041]
    101091022
   03009 Ribosome biogenesis [BR:fca03009]
    101091022
   03110 Chaperones and folding catalysts [BR:fca03110]
    101091022
   04131 Membrane trafficking [BR:fca04131]
    101091022
   03051 Proteasome [BR:fca03051]
    101091022
   03029 Mitochondrial biogenesis [BR:fca03029]
    101091022
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101091022
Protein phosphatases and associated proteins [BR:fca01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     101091022
Spliceosome [BR:fca03041]
 Complex B
  Other components
   Prp19 complex
    101091022
 Complex C
   Prp19-CDC5 complex
    101091022
Ribosome biogenesis [BR:fca03009]
 Eukaryotic Type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    101091022
Chaperones and folding catalysts [BR:fca03110]
 Heat shock proteins
  HSP70 / DNAK
   101091022
Membrane trafficking [BR:fca04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    101091022
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    101091022
Proteasome [BR:fca03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    101091022
Mitochondrial biogenesis [BR:fca03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    101091022
Exosome [BR:fca04147]
 Exosomal proteins
  Proteins found in most exosomes
   101091022
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C DUF1464 Radial_spoke_3
Motif
Other DBs
NCBI-GeneID: 101091022
NCBI-ProteinID: XP_003985991
Ensembl: ENSFCAG00000004376
UniProt: M3W226
Position
B2
AA seq 641 aa AA seqDB search
MAAAKGMAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ
VAMNPQNTVFDAKRLIGRKFNDPVVQADMKHWPFQVINEGGKPKVTVSYKGEKKAFYPEE
ISSMVLTKMKETAEAFLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTA
AAIAYGLDKAGQGERHVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLV
SHFVEEFKRKYKKDIIQNKRAVRRLRTACERAKRTLSSSTQANLEIDSLYEGVDFYTSIT
RARFEELCADLFRGTLEPVEKALQDAKMDKAKIHDIVLVGGSTRIPKVQRLLQDYFNGHD
LNKSINPDEAVAYGAAVQAAILMGDKSEKVQDLLLLDVAPLSLGLETAGGVMTVLIKRNS
TIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTRDNNLLGRFDLTGIPPAPRGVPQIEVTF
DIDANGILNVTAMDKSTGKANKITITNDKGRLSKEEIERMVLDAEKYKAEDEVQREKITA
KNALESYAFNMKSAVSDEGLKGKISESDKKKILDKCNEVLSWLEANQLAEKEEFDHKRKE
LEQVCNPVITKLYQGGCAGPTCGTGYTPGRAATGPTIEEVD
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atggctgctgctaagggaatggccattggcatcgacctgggcaccacctactcatgcgtg
ggggtgttccagcacggtaaggtagagatcattgccaacgaccagggcaaccgcaccacc
cccagctatgtggccttcactgacacggaacggctcattggggatgcggccaagaaccag
gtagcaatgaatccccagaacactgtctttgacgccaaacgtctgattggcaggaaattt
aatgatcctgtagtgcaggcagatatgaaacactggccttttcaagtaatcaatgaagga
ggcaagcccaaggtaacagtgtcctacaaaggggagaaaaaagctttctatcctgaggaa
atctcttctatggtactgacaaagatgaaggagactgctgaggcctttttgggccaccct
gtcaccaatgctgtgataactgtgccagcttatttcaatgattctcagcgtcaagccacc
aaggatgcaggtgtgattgcgggtctcaatgtgctaagaattatcaatgaacccacagct
gctgccattgcatatggcttagataaagcaggtcagggagagcgacatgtcttgatcttt
gacctgggtggaggaacatttgatgtgtccatcctgacgatagatgatggaatctttgaa
gtaaaggccacagctggggacacccaccttggtggagaggactttgacaacaggcttgtg
agccactttgtggaggaattcaagaggaagtacaagaaggacatcatccagaacaagcga
gccgtgaggcggctgcgcaccgcctgcgagcgggccaagaggaccctgtcgtccagcacc
caggccaacttggaaattgattcactttatgaaggtgtcgacttctacacgtccatcacc
agagcccgatttgaagagttgtgtgcagacctgtttagaggcacgttggaacctgtggag
aaggctcttcaggatgccaagatggataaggctaagatccatgacattgttttagtaggg
ggctccacccgcatccctaaagttcagaggctgctacaggactactttaatggtcatgat
ctcaataagagcatcaatccagatgaggcagtggcctatggggctgctgtacaggcagcc
attttgatgggggacaaatctgaaaaggtacaggacctgcttttgctggatgtggctccc
ttgtccctagggttggaaacagccgggggtgtgatgactgtcctgatcaagcgcaactct
accatccccaccaagcagacgcagatcttcaccacctattcagataaccagccaggggta
ttgatccaggtgtatgagggcgagagggccatgacccgagacaacaacctgctggggcgc
tttgacctgactggaatccctcctgcacccaggggagtgcctcagattgaagtgaccttt
gacatcgatgccaacggtattctcaatgtaacagccatggacaagagcacgggcaaggcc
aacaagatcaccatcaccaacgacaagggccggctgagcaaggaggagattgaacgcatg
gtcctggatgctgagaagtacaaagctgaggatgaggtccaaagagagaaaatcactgca
aaaaatgccttagaatcttatgcttttaacatgaagagtgctgtgagtgatgagggcttg
aagggcaagattagtgagtctgataaaaagaaaatactggataaatgcaatgaggtcctt
tcgtggctggaggccaatcaactggctgagaaagaagagtttgatcacaagagaaaggaa
ttggagcaggtgtgtaacccagtcatcaccaaactctaccagggaggatgcgctgggcct
acctgtgggacagggtatactcctggaagggctgccacaggccccaccatcgaagaagta
gattaa

DBGET integrated database retrieval system