KEGG   Felis catus (domestic cat): 101087555Help
Entry
101087555         CDS       T02385                                 

Gene name
ADCY8
Definition
(RefSeq) adenylate cyclase type 8 isoform X1
  KO
K08048  adenylate cyclase 8 [EC:4.6.1.1]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00230  Purine metabolism
fca01100  Metabolic pathways
fca01522  Endocrine resistance
fca04015  Rap1 signaling pathway
fca04020  Calcium signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04024  cAMP signaling pathway
fca04062  Chemokine signaling pathway
fca04072  Phospholipase D signaling pathway
fca04114  Oocyte meiosis
fca04211  Longevity regulating pathway
fca04213  Longevity regulating pathway - multiple species
fca04261  Adrenergic signaling in cardiomyocytes
fca04270  Vascular smooth muscle contraction
fca04371  Apelin signaling pathway
fca04540  Gap junction
fca04611  Platelet activation
fca04713  Circadian entrainment
fca04714  Thermogenesis
fca04720  Long-term potentiation
fca04723  Retrograde endocannabinoid signaling
fca04724  Glutamatergic synapse
fca04725  Cholinergic synapse
fca04727  GABAergic synapse
fca04742  Taste transduction
fca04750  Inflammatory mediator regulation of TRP channels
fca04911  Insulin secretion
fca04912  GnRH signaling pathway
fca04913  Ovarian steroidogenesis
fca04914  Progesterone-mediated oocyte maturation
fca04915  Estrogen signaling pathway
fca04916  Melanogenesis
fca04918  Thyroid hormone synthesis
fca04921  Oxytocin signaling pathway
fca04923  Regulation of lipolysis in adipocytes
fca04925  Aldosterone synthesis and secretion
fca04926  Relaxin signaling pathway
fca04927  Cortisol synthesis and secretion
fca04928  Parathyroid hormone synthesis, secretion and action
fca04934  Cushing syndrome
fca04970  Salivary secretion
fca04971  Gastric acid secretion
fca04972  Pancreatic secretion
fca04976  Bile secretion
fca05032  Morphine addiction
fca05163  Human cytomegalovirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05200  Pathways in cancer
fca05414  Dilated cardiomyopathy (DCM)
Module
fca_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    101087555 (ADCY8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101087555 (ADCY8)
   04371 Apelin signaling pathway
    101087555 (ADCY8)
   04020 Calcium signaling pathway
    101087555 (ADCY8)
   04072 Phospholipase D signaling pathway
    101087555 (ADCY8)
   04024 cAMP signaling pathway
    101087555 (ADCY8)
   04022 cGMP-PKG signaling pathway
    101087555 (ADCY8)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101087555 (ADCY8)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101087555 (ADCY8)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101087555 (ADCY8)
   04062 Chemokine signaling pathway
    101087555 (ADCY8)
  09152 Endocrine system
   04911 Insulin secretion
    101087555 (ADCY8)
   04923 Regulation of lipolysis in adipocytes
    101087555 (ADCY8)
   04912 GnRH signaling pathway
    101087555 (ADCY8)
   04913 Ovarian steroidogenesis
    101087555 (ADCY8)
   04915 Estrogen signaling pathway
    101087555 (ADCY8)
   04914 Progesterone-mediated oocyte maturation
    101087555 (ADCY8)
   04921 Oxytocin signaling pathway
    101087555 (ADCY8)
   04926 Relaxin signaling pathway
    101087555 (ADCY8)
   04918 Thyroid hormone synthesis
    101087555 (ADCY8)
   04928 Parathyroid hormone synthesis, secretion and action
    101087555 (ADCY8)
   04916 Melanogenesis
    101087555 (ADCY8)
   04925 Aldosterone synthesis and secretion
    101087555 (ADCY8)
   04927 Cortisol synthesis and secretion
    101087555 (ADCY8)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101087555 (ADCY8)
   04270 Vascular smooth muscle contraction
    101087555 (ADCY8)
  09154 Digestive system
   04970 Salivary secretion
    101087555 (ADCY8)
   04971 Gastric acid secretion
    101087555 (ADCY8)
   04972 Pancreatic secretion
    101087555 (ADCY8)
   04976 Bile secretion
    101087555 (ADCY8)
  09156 Nervous system
   04724 Glutamatergic synapse
    101087555 (ADCY8)
   04727 GABAergic synapse
    101087555 (ADCY8)
   04725 Cholinergic synapse
    101087555 (ADCY8)
   04720 Long-term potentiation
    101087555 (ADCY8)
   04723 Retrograde endocannabinoid signaling
    101087555 (ADCY8)
  09157 Sensory system
   04742 Taste transduction
    101087555 (ADCY8)
   04750 Inflammatory mediator regulation of TRP channels
    101087555 (ADCY8)
  09149 Aging
   04211 Longevity regulating pathway
    101087555 (ADCY8)
   04213 Longevity regulating pathway - multiple species
    101087555 (ADCY8)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101087555 (ADCY8)
   04714 Thermogenesis
    101087555 (ADCY8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101087555 (ADCY8)
  09165 Substance dependence
   05032 Morphine addiction
    101087555 (ADCY8)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    101087555 (ADCY8)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101087555 (ADCY8)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101087555 (ADCY8)
   05163 Human cytomegalovirus infection
    101087555 (ADCY8)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101087555 (ADCY8)
Enzymes [BR:fca01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     101087555 (ADCY8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc AC_N DUF1053 TBK1_ULD
Motif
Other DBs
NCBI-GeneID: 101087555
NCBI-ProteinID: XP_004000169
Ensembl: ENSFCAG00000006436
UniProt: M3W5W8
Position
F2
AA seq 1252 aa AA seqDB search
MELSDVRCLSGSEELYTIHPTPPAGDGGSGSRPQRLLWQTAVRHITEQRFIHGHRGSGGG
SGSRGSGKASDAAGGGPNHHAAQLSGDSALPLYSLGPGERAHSSGGTKVFPERSGSGSGS
GSGGGGDLGFLHLDCAPSNSDFFLNGGYSYRGVIFPTLRNSFKSRDLERLYQRYFLGQRR
KSEVVMNVLDVLTKLTLLVLHLSLASAPMDPLKGILLGFFTGIEVVICALVVVRKDTTSH
TYLQYSGVVTWVAMTTQILAAGLGYGLLGDGIGYVLFTLFATYSMLPLPLTWAILAGLGT
SLLQVVVQVAIPRLAVISINQVMAQAVLFMCMNTAGTFISYLSDRAQRQAFLETRRCVEA
RLRLETENQRQERLVLSVLPRFVVLEMINDMTNVEDEHLQHQFHRIYIHRYENVSILFAD
VKGFTNLSTTLSAQELVRMLNELFARFDRLAHEHHCLRIKILGDCYYCVSGLPEPRQDHA
HCCVEMGLSMIKTIRYVRSRTKHDVDMRIGIHSGSVLCGVLGLRKWQFDVWSWDVDIANK
LESGGIPGRIHISKATLDCLNGDYNVEEGHGKERNEFLRKHNIETYLIKQPEESLLTLPE
DIVKESVSFSDTRNSGATFTEGSWSPELPFDNIVGKQNTLAALTRNSINLLPNHLAQALH
VQSGPEEINKRIEHTIDLRSGDKLRREHIKPFSLMFKDSSLEHKYSQMRDEVFKSNLVCA
FIVLLFITAIQSLLPSSRVMPMAIQFSILIMLHSALVLITTAEDYKCLPLVLRKTCCWIN
ETYLARNVIIFASILINFLGAILNILWCDFDKSIPLKNLTFNSSAVFTDICSCPEYFVFT
GVLAMVTCAVFLRLNSVLKLAVLLIMIAIYALLTETVYAGLFLRYDNLNHSGEDFLGTKE
ASLLLMAMFLLAVFYHGQQLEYTARLDFLWRVQAKEEINEMKELREHNENMLRNILPSHV
ARHFLEKDRDNEELYSQSYDAVGVMFASIPGFADFYSQTEMNNQGVECLRLLNEIIADFD
ELLGEDRFQDIEKIKTIGSTYMAVSGLSPEKQQCEDKWGHLCALADFSLALTESIQEINK
HSFNNFELRIGISHGSVVAGVIGAKKPQYDIWGKTVNLASRMDSTGVSGRIQVPEETYLI
LKDQGFAFDYRGEIYVKGISEQEGKIKTYFLLGRVQPNPFILPPRRLPGQYSLAAVVLGL
VQSLNRQRQKQLLNENINTGIIKGHYNRRTLLTPSGPEPGAQAEGADKSDLP
NT seq 3759 nt NT seq  +upstreamnt  +downstreamnt
atggagctctccgatgtgcgctgcctgagcggcagcgaggaactctacaccatccacccg
acgcccccggccggcgacggcgggagcggctcccggccgcagcggctgctgtggcagacg
gcggtgaggcacatcaccgagcagcgcttcattcacgggcaccggggcagcggcggcggc
agcgggagtagaggctccggcaaagcctcggacgctgcaggcggcggccccaaccaccac
gcggcgcagctgtccggggactcggcgctgcccctctactcgctgggccccggggagaga
gcgcacagctccggtggcaccaaagtcttcccggaacgcagcgggagcggcagcggcagc
ggcagcgggggcgggggcgatctgggcttcctgcacctggactgcgccccgagcaactcg
gatttcttcctcaatgggggctatagctaccgaggggtcattttccccactctgcgcaac
tccttcaagtccagggatctggagcgcctctaccagcgctatttcctgggccagaggcgc
aaatccgaggtggtgatgaacgtgctggacgtgctgaccaaactcaccctcttggtcctc
cacctgagcctggcctcggcccccatggacccgctcaagggcattctcctgggcttcttc
actggcatcgaggtggtgatctgcgcgctcgtggtggtcaggaaggacaccacctcgcac
acgtacctgcagtacagcggcgtggtcacttgggtggccatgaccacccagatcttggca
gcaggcctcggctacgggcttctgggtgatggcatcggctacgtcctcttcacgctgttc
gccacctacagcatgctgccgctgccactcacctgggccatcctggccggcctgggcacc
tcgctgctgcaggtggtcgtgcaggtggccattccccggctggcggtcatctccatcaac
caggtgatggcccaggcagtgctgttcatgtgtatgaacacggctggaaccttcatcagt
tacctgtcagaccgggcccagcgccaagccttcctggagacacggaggtgtgtggaggcc
aggctgcgcctggagacggaaaaccaaagacaggagcggctcgtgctgtctgtgcttccc
cggtttgtcgtcctggaaatgatcaatgacatgaccaatgttgaagacgagcacctgcag
caccaattccatcggatctacatccaccgctatgagaatgtcagtattcttttcgcagat
gtgaaaggatttaccaacctctccacaaccttgtctgcccaggagctggtcaggatgctc
aacgagctctttgcgagatttgatcgactggcccacgagcatcactgccttcgcattaaa
atcctgggggactgttactactgtgtttcagggcttccagagccccgccaggaccacgcc
cactgctgcgttgaaatgggcctcagcatgatcaaaaccatcaggtatgtgaggtcaagg
acgaagcatgatgttgacatgcggatcggaatccactcgggctcggtgctgtgtggcgtg
ttgggtctgaggaagtggcagtttgatgtctggtcttgggacgtggacatcgcgaacaaa
cttgagtctggaggaatccctgggaggattcacatttccaaagccacgctggactgcctc
aacggtgactataatgtggaagagggtcatggtaaagagagaaacgaattcttgaggaag
cataacatagagacctatttgattaagcagcctgaggagagcctactgacgttgcccgaa
gacattgtcaaggagtcggtgagcttctcagacacgagaaacagtggggcgacattcaca
gaaggatcctggagccccgaactgccctttgataacatagtggggaaacagaacactctg
gctgccctaacaagaaattcaataaatctacttccaaaccatcttgcacaagctttgcat
gtccagtctgggcctgaggaaattaacaagagaatagaacataccatcgacttgcggagt
ggcgataaattgagaagagagcatatcaagccattctcactgatgtttaaagactccagc
ctggagcacaagtattctcaaatgagggatgaagtattcaagtcaaacttggtctgtgca
tttatcgttctcctatttatcacggcaatccaaagtttgcttccttcttcaagggtgatg
ccaatggccatccagttttccatcctgatcatgctgcactcggctctggtcctcatcacc
acggcagaagattacaagtgtttgcctctcgtcctccggaaaacttgctgttggattaac
gagacctacttagcccggaacgtcatcatctttgcatccatcttgattaacttcctgggc
gccatcttgaatatcctgtggtgtgattttgacaagtcgatacccttgaagaacctgact
ttcaattcctcagctgtgtttacagatatctgctcctgcccagagtacttcgtcttcact
ggggtgttggccatggtcacctgtgcggttttcctccgcctgaactctgtcctgaagctg
gccgtgctgctgattatgattgccatctacgcgctgctgactgagaccgtctacgcgggc
ctcttcctgcgctatgacaacctaaaccacagcggagaagatttcctggggaccaaggag
gcgtcactgctgctgatggccatgttcctccttgccgtgttctaccacggacagcagctg
gagtacacggcccgcctggacttcctttggcgagtgcaggccaaagaggagatcaacgag
atgaaggagctcagggagcacaatgagaacatgctccggaacattctacccagccacgtg
gcccgccacttcctggagaaagaccgagacaacgaggagctgtattcccaatcttatgat
gccgtcggggtgatgttcgcctccatcccggggtttgcagacttttactctcagactgag
atgaataaccagggagtagaatgcctgcgtctgttgaatgagatcattgctgacttcgat
gagctgctaggcgaagaccggtttcaggacattgaaaagattaagaccatcggcagcacc
tacatggccgtgtcgggcctgtcacctgaaaaacagcaatgtgaagacaagtggggacat
ctgtgtgccctggccgacttctccctcgccctgaccgaaagcatacaggagatcaacaaa
cattccttcaacaatttcgaactccggattggcatcagtcacggctccgtggtagctggg
gtcatcggcgctaagaagccgcaatatgacatttggggcaaaactgtgaacctggcgagc
cgaatggacagcacgggggtcagcggcaggatccaagtccccgaggagacctatctcatc
ctgaaggaccagggctttgccttcgactaccgaggggagatctacgtgaagggcatcagt
gagcaggaaggaaaaatcaaaacgtactttctcctgggaagagtccaacccaacccgttc
atcctgcccccgagaagactgcccgggcagtactcactggccgcggtcgtcctgggcctt
gtccagtccctcaacaggcaaaggcagaagcagttgctcaatgagaacatcaacacaggg
atcatcaagggccactacaaccggcggactttgctgacacccagtgggccagagcccggg
gcccaggctgagggcgccgacaagtccgatttgccatga

KEGG   Felis catus (domestic cat): 101088157Help
Entry
101088157         CDS       T02385                                 

Gene name
ADCY3
Definition
(RefSeq) adenylate cyclase type 3 isoform X1
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00230  Purine metabolism
fca01100  Metabolic pathways
fca01522  Endocrine resistance
fca04015  Rap1 signaling pathway
fca04020  Calcium signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04024  cAMP signaling pathway
fca04062  Chemokine signaling pathway
fca04072  Phospholipase D signaling pathway
fca04114  Oocyte meiosis
fca04211  Longevity regulating pathway
fca04213  Longevity regulating pathway - multiple species
fca04261  Adrenergic signaling in cardiomyocytes
fca04270  Vascular smooth muscle contraction
fca04371  Apelin signaling pathway
fca04540  Gap junction
fca04611  Platelet activation
fca04713  Circadian entrainment
fca04714  Thermogenesis
fca04723  Retrograde endocannabinoid signaling
fca04724  Glutamatergic synapse
fca04725  Cholinergic synapse
fca04727  GABAergic synapse
fca04740  Olfactory transduction
fca04750  Inflammatory mediator regulation of TRP channels
fca04911  Insulin secretion
fca04912  GnRH signaling pathway
fca04913  Ovarian steroidogenesis
fca04914  Progesterone-mediated oocyte maturation
fca04915  Estrogen signaling pathway
fca04916  Melanogenesis
fca04918  Thyroid hormone synthesis
fca04921  Oxytocin signaling pathway
fca04923  Regulation of lipolysis in adipocytes
fca04925  Aldosterone synthesis and secretion
fca04926  Relaxin signaling pathway
fca04927  Cortisol synthesis and secretion
fca04928  Parathyroid hormone synthesis, secretion and action
fca04934  Cushing syndrome
fca04962  Vasopressin-regulated water reabsorption
fca04970  Salivary secretion
fca04971  Gastric acid secretion
fca04972  Pancreatic secretion
fca04976  Bile secretion
fca05032  Morphine addiction
fca05163  Human cytomegalovirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05200  Pathways in cancer
fca05414  Dilated cardiomyopathy (DCM)
Module
fca_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    101088157 (ADCY3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101088157 (ADCY3)
   04371 Apelin signaling pathway
    101088157 (ADCY3)
   04020 Calcium signaling pathway
    101088157 (ADCY3)
   04072 Phospholipase D signaling pathway
    101088157 (ADCY3)
   04024 cAMP signaling pathway
    101088157 (ADCY3)
   04022 cGMP-PKG signaling pathway
    101088157 (ADCY3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101088157 (ADCY3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101088157 (ADCY3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101088157 (ADCY3)
   04062 Chemokine signaling pathway
    101088157 (ADCY3)
  09152 Endocrine system
   04911 Insulin secretion
    101088157 (ADCY3)
   04923 Regulation of lipolysis in adipocytes
    101088157 (ADCY3)
   04912 GnRH signaling pathway
    101088157 (ADCY3)
   04913 Ovarian steroidogenesis
    101088157 (ADCY3)
   04915 Estrogen signaling pathway
    101088157 (ADCY3)
   04914 Progesterone-mediated oocyte maturation
    101088157 (ADCY3)
   04921 Oxytocin signaling pathway
    101088157 (ADCY3)
   04926 Relaxin signaling pathway
    101088157 (ADCY3)
   04918 Thyroid hormone synthesis
    101088157 (ADCY3)
   04928 Parathyroid hormone synthesis, secretion and action
    101088157 (ADCY3)
   04916 Melanogenesis
    101088157 (ADCY3)
   04925 Aldosterone synthesis and secretion
    101088157 (ADCY3)
   04927 Cortisol synthesis and secretion
    101088157 (ADCY3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101088157 (ADCY3)
   04270 Vascular smooth muscle contraction
    101088157 (ADCY3)
  09154 Digestive system
   04970 Salivary secretion
    101088157 (ADCY3)
   04971 Gastric acid secretion
    101088157 (ADCY3)
   04972 Pancreatic secretion
    101088157 (ADCY3)
   04976 Bile secretion
    101088157 (ADCY3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    101088157 (ADCY3)
  09156 Nervous system
   04724 Glutamatergic synapse
    101088157 (ADCY3)
   04727 GABAergic synapse
    101088157 (ADCY3)
   04725 Cholinergic synapse
    101088157 (ADCY3)
   04723 Retrograde endocannabinoid signaling
    101088157 (ADCY3)
  09157 Sensory system
   04740 Olfactory transduction
    101088157 (ADCY3)
   04750 Inflammatory mediator regulation of TRP channels
    101088157 (ADCY3)
  09149 Aging
   04211 Longevity regulating pathway
    101088157 (ADCY3)
   04213 Longevity regulating pathway - multiple species
    101088157 (ADCY3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101088157 (ADCY3)
   04714 Thermogenesis
    101088157 (ADCY3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101088157 (ADCY3)
  09165 Substance dependence
   05032 Morphine addiction
    101088157 (ADCY3)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    101088157 (ADCY3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101088157 (ADCY3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101088157 (ADCY3)
   05163 Human cytomegalovirus infection
    101088157 (ADCY3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101088157 (ADCY3)
Enzymes [BR:fca01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     101088157 (ADCY3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc AC_N HNOBA NCE101 Peptidase_S49_N fn3_4
Motif
Other DBs
NCBI-GeneID: 101088157
NCBI-ProteinID: XP_011279570
Ensembl: ENSFCAG00000003651
Position
A3
AA seq 1152 aa AA seqDB search
MPRNQGFSEPEYSAEYSAEYSVSLPSDPDRGVGRTHEISVRNSGSCLCLPRFMRLTFVPE
SLENLYQTYFKRQRHETLLVLVVFAALFDCYVVVMCAVVYSSDKLAPLVVAGMGLLLDIL
LFVLCKKGLLPDRVTRKVVPYLLWLLITAQIFSYLGLNFARAHAASDTVGWQTFFVFSFF
ITLPLSLSPIVIISVVSCVVHTLVLGVTVAQQQQDGLKGRHLLREILANVCLYLCAIMVG
VMSYYMADRKHRKAFLEARQSLEVKMNLEEQSQQQENLMLSILPKHVADEMLKDMKKDES
QKDQQQFNTMYMYRHENVSILFADIVGFTQLSSACSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYREDHAVCSILMGLAMVEAISYVREKTKTGVDMRVGVHTGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMDCLKGEFDVEPGDGGSRCE
YLDEKGIETYLIIASKPEVKKTAAQHGLDGPALLNGAPASSKPSSPALIETKEPNGSIHT
SGSTSEEPEEQDAQADNPSFPNPRRRLRLQDLADRVVDASEDEHELNQLLNEALLERESA
QVVKKRNTFLLSMRFMDPEMETRYSVEKEKQSGAAFSCSCVVLLCTALVEILIDPWLMTN
YMTFVVGEVLLLILTVCSLAAIFPRAFPKKLVAFSTWIDRTRWARNTWAMLAIFILVMAN
VVDMLSCLQYHTGPVNSTAGTEAEDGCVENPKYYSYVAVLSLIATIMLVQVSHMVKLTLM
LLVTGAVAVINIYAWRPIFDEYDRKRFQEHDFPVVALEKMQVLSTPGLNGTDRLPLVPSK
YSMTVMIFIMMLSFYYFSRHVEKLARTLFLWKIEVHDQKERVYEMRRWNEALVTNMLPEH
VARHFLGSKKRDEELYSQSYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDF
DSLLDNPKFRVITKIKTIGSTYMAASGVTPDVNTNGFANSNKEEKSDRERWQHLADLADF
ALAMKDTLTNINNQSFNNFMLRIGMNKGGVLAGVIGARKPHYDIWGNTVNVASRMESTGV
MGNIQVCPARAEHVLRPRDRAQSQNRGCFATCYCLLSVGPGYQVGVFGRLKARVERDASG
EGRKYFDPISKI
NT seq 3459 nt NT seq  +upstreamnt  +downstreamnt
atgccaaggaaccagggcttttcggagcccgagtactcggctgagtactccgccgaatac
tcggtcagcctgccctctgaccccgaccgcggggtgggccggacccatgaaatctctgtc
cggaactcgggatcctgcctctgcctgcctcgattcatgaggctgaccttcgtgcccgag
tccttggagaacttgtaccagacctacttcaaacggcagcgccatgagacgctgctggtg
ctggtggtctttgcggccctcttcgactgctacgtggtggtcatgtgcgcggtggtctac
tccagcgacaagctggctcccctggtcgtcgctgggatgggactgctgttggacatcctc
ctcttcgtgctctgcaaaaaggggcttctccccgaccgtgtcacccggaaagtggtgccc
tacctgctgtggctgctgataactgcccagattttctcctacctgggcctgaactttgcc
cgcgcgcatgcggccagcgacacggtgggctggcagaccttctttgtcttctccttcttc
atcacgctgcccctcagcctcagccccatcgtcatcatctccgtggtctcctgtgttgtg
cacacactcgtcttgggggtcaccgtggcccagcagcagcaggatggcctgaaaggcagg
cacttgctgagggagatcctggccaacgtctgcctctacctgtgtgccatcatggtgggc
gtcatgtcctactacatggcggaccgcaagcaccgcaaggccttcctggaggcccgccag
tcgctggaggtgaaaatgaacctcgaggagcagagccagcagcaggagaaccttatgctt
tccatcctgcccaagcatgtggctgacgagatgctaaaggacatgaagaaggacgagagc
caaaaggaccagcagcagttcaacaccatgtacatgtatcgccacgagaatgtcagcatc
ctcttcgcggacatcgtgggcttcacccagctgtcttccgcctgcagtgcccaggagctc
gtgaagctgctcaacgagctcttcgcccgctttgacaagctggcggccaaataccaccag
ctgcggattaagatcctgggcgactgttactactgcatctgcggcctgcccgactaccgg
gaggaccacgccgtctgctccatccttatggggctcgccatggtggaggccatctcgtat
gtgcgggagaagacgaagactggggtggacatgcgtgtgggggtgcacacaggcacggtg
ctggggggcgtcctgggccagaagcgctggcagtatgacgtgtggtccactgacgtcact
gtggccaacaagatggaggccggtggcatccccgggcgtgtgcacatctcccagagcacc
atggactgcctaaagggcgagttcgacgtggagccgggcgacgggggcagccgctgcgag
tacttggacgagaagggcatcgagacctacctcatcatcgcgtccaagccagaggtgaag
aaaacagccgcccagcacggcctcgacggcccggccctgctgaatggagcgccagcttcc
tcaaagcccagctctcccgccctcattgagaccaaggagcccaacggaagcatccacacc
agcggctccacgtcagaggagcccgaggagcaggatgcccaggcggacaatccctcgttc
cccaacccgcgccggaggctgcgccttcaggacctggctgatcgagtggtggacgcctct
gaggacgagcatgagctcaaccagctactcaatgaggccctgcttgagcgagagtccgcc
caggtagtgaagaagagaaacaccttcctcctttccatgcggttcatggaccccgagatg
gaaacccgctactccgtggagaaggaaaagcagagtggggccgcctttagctgctcctgt
gttgtcctgctctgtacggccctggtcgagatactcatcgacccctggctgatgacaaat
tacatgacctttgtggtcggggaggttctccttctgatcctgacggtctgctcgctggcc
gccatctttccccgggcctttcctaagaagctcgtggccttctcgacttggatcgaccgg
acccgctgggccagaaacacctgggccatgttagccatcttcattctggttatggcaaac
gttgtggacatgcttagctgcctgcagtaccacacaggccccgtcaacagcaccgcaggg
acggaggcagaggatggctgcgtagagaaccccaagtattacagctatgtcgctgtgctg
tccctcatcgccaccatcatgctggtgcaggtcagccacatggtgaagctcacactcatg
ctgcttgtcacgggtgctgtggccgtcatcaacatctacgcctggcgccccatctttgat
gaatatgaccgcaaacgtttccaggaacatgactttcctgtggtcgccttagagaagatg
caggtactttccacccccgggctcaacggcactgacaggctgcccctggtgccttctaag
tactccatgacagtgatgatcttcatcatgatgctgagcttttactacttctcgcgccac
gtggaaaaattggcacggacactgttcttgtggaagattgaggtccatgaccagaaggaa
cgcgtctacgagatgcggcgctggaatgaggccttggtcaccaacatgttgcctgagcac
gtggcacgccatttcctggggtccaagaaaagagatgaggagctgtacagccagtcttac
gatgagatcggagtcatgtttgcctccctgcccaacttcgccgacttctacacagaggag
agcatcaataatggtggcatcgagtgtctgcgcttcctcaacgagatcatctcagatttt
gattctctcctggacaatcctaagttccgggtcatcaccaagatcaaaaccatcggcagc
acctatatggcagcttcaggagtcaccccggatgtcaacaccaatggcttcgccaactcc
aacaaggaggaaaagtctgaccgggagcgctggcagcacctggctgacctggctgacttc
gctctggccatgaaggacacactcaccaacatcaacaaccagtccttcaacaacttcatg
ctgcgcataggcatgaacaaaggaggggtactggctggggtcattggagcccggaaacca
cattatgacatctggggcaatacggtcaatgtagccagcaggatggagtccacaggggtc
atgggtaacattcaggtatgtccagcgagagccgagcatgtgctcagacccagggaccgg
gcacaaagtcagaatagggggtgcttcgccacatgctactgcctcctttctgttggccca
ggttatcaagttggtgtttttggaagattaaaggcaagggtggaaagggatgcctcagga
gaagggaggaaatacttcgaccccatttccaaaatttag

KEGG   Felis catus (domestic cat): 101091211Help
Entry
101091211         CDS       T02385                                 

Gene name
ADCY6
Definition
(RefSeq) adenylate cyclase type 6 isoform X2
  KO
K08046  adenylate cyclase 6 [EC:4.6.1.1]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00230  Purine metabolism
fca01100  Metabolic pathways
fca01522  Endocrine resistance
fca04015  Rap1 signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04024  cAMP signaling pathway
fca04062  Chemokine signaling pathway
fca04072  Phospholipase D signaling pathway
fca04114  Oocyte meiosis
fca04211  Longevity regulating pathway
fca04213  Longevity regulating pathway - multiple species
fca04261  Adrenergic signaling in cardiomyocytes
fca04270  Vascular smooth muscle contraction
fca04371  Apelin signaling pathway
fca04540  Gap junction
fca04611  Platelet activation
fca04713  Circadian entrainment
fca04714  Thermogenesis
fca04723  Retrograde endocannabinoid signaling
fca04724  Glutamatergic synapse
fca04725  Cholinergic synapse
fca04727  GABAergic synapse
fca04742  Taste transduction
fca04750  Inflammatory mediator regulation of TRP channels
fca04911  Insulin secretion
fca04912  GnRH signaling pathway
fca04913  Ovarian steroidogenesis
fca04914  Progesterone-mediated oocyte maturation
fca04915  Estrogen signaling pathway
fca04916  Melanogenesis
fca04918  Thyroid hormone synthesis
fca04921  Oxytocin signaling pathway
fca04923  Regulation of lipolysis in adipocytes
fca04924  Renin secretion
fca04925  Aldosterone synthesis and secretion
fca04926  Relaxin signaling pathway
fca04927  Cortisol synthesis and secretion
fca04928  Parathyroid hormone synthesis, secretion and action
fca04934  Cushing syndrome
fca04961  Endocrine and other factor-regulated calcium reabsorption
fca04962  Vasopressin-regulated water reabsorption
fca04970  Salivary secretion
fca04971  Gastric acid secretion
fca04972  Pancreatic secretion
fca04976  Bile secretion
fca05032  Morphine addiction
fca05163  Human cytomegalovirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05200  Pathways in cancer
fca05414  Dilated cardiomyopathy (DCM)
Module
fca_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    101091211 (ADCY6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101091211 (ADCY6)
   04371 Apelin signaling pathway
    101091211 (ADCY6)
   04072 Phospholipase D signaling pathway
    101091211 (ADCY6)
   04024 cAMP signaling pathway
    101091211 (ADCY6)
   04022 cGMP-PKG signaling pathway
    101091211 (ADCY6)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101091211 (ADCY6)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101091211 (ADCY6)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101091211 (ADCY6)
   04062 Chemokine signaling pathway
    101091211 (ADCY6)
  09152 Endocrine system
   04911 Insulin secretion
    101091211 (ADCY6)
   04923 Regulation of lipolysis in adipocytes
    101091211 (ADCY6)
   04912 GnRH signaling pathway
    101091211 (ADCY6)
   04913 Ovarian steroidogenesis
    101091211 (ADCY6)
   04915 Estrogen signaling pathway
    101091211 (ADCY6)
   04914 Progesterone-mediated oocyte maturation
    101091211 (ADCY6)
   04921 Oxytocin signaling pathway
    101091211 (ADCY6)
   04926 Relaxin signaling pathway
    101091211 (ADCY6)
   04918 Thyroid hormone synthesis
    101091211 (ADCY6)
   04928 Parathyroid hormone synthesis, secretion and action
    101091211 (ADCY6)
   04916 Melanogenesis
    101091211 (ADCY6)
   04924 Renin secretion
    101091211 (ADCY6)
   04925 Aldosterone synthesis and secretion
    101091211 (ADCY6)
   04927 Cortisol synthesis and secretion
    101091211 (ADCY6)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101091211 (ADCY6)
   04270 Vascular smooth muscle contraction
    101091211 (ADCY6)
  09154 Digestive system
   04970 Salivary secretion
    101091211 (ADCY6)
   04971 Gastric acid secretion
    101091211 (ADCY6)
   04972 Pancreatic secretion
    101091211 (ADCY6)
   04976 Bile secretion
    101091211 (ADCY6)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    101091211 (ADCY6)
   04961 Endocrine and other factor-regulated calcium reabsorption
    101091211 (ADCY6)
  09156 Nervous system
   04724 Glutamatergic synapse
    101091211 (ADCY6)
   04727 GABAergic synapse
    101091211 (ADCY6)
   04725 Cholinergic synapse
    101091211 (ADCY6)
   04723 Retrograde endocannabinoid signaling
    101091211 (ADCY6)
  09157 Sensory system
   04742 Taste transduction
    101091211 (ADCY6)
   04750 Inflammatory mediator regulation of TRP channels
    101091211 (ADCY6)
  09149 Aging
   04211 Longevity regulating pathway
    101091211 (ADCY6)
   04213 Longevity regulating pathway - multiple species
    101091211 (ADCY6)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101091211 (ADCY6)
   04714 Thermogenesis
    101091211 (ADCY6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101091211 (ADCY6)
  09165 Substance dependence
   05032 Morphine addiction
    101091211 (ADCY6)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    101091211 (ADCY6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101091211 (ADCY6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101091211 (ADCY6)
   05163 Human cytomegalovirus infection
    101091211 (ADCY6)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101091211 (ADCY6)
Enzymes [BR:fca01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     101091211 (ADCY6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc AC_N DUF1053 HNOBA TBK1_ULD Shisa
Motif
Other DBs
NCBI-GeneID: 101091211
NCBI-ProteinID: XP_006933719
Ensembl: ENSFCAG00000000079
Position
B4
AA seq 1262 aa AA seqDB search
MCWCGACPGAREWTFQFLPDLLCLLTQALELVTTKKSVLFREEVNVEVYCFGVRQIWVRI
LVPTHPWLLDVGRVTRLLLSRFPHLLNGDPVVLLHTFIMSWFSGLLVPKVDERKTAWGER
NGQKRPRRGTRTSGFCTPRYMSCLRDAQPPSPTPAAPPRCPWQDETFMRRGGPGKEPGLR
AVALGFEDTEAMAAVGAAEVAPDVAARGRRSCWRRLAQVFQSKQFRSAKLERLYQRYFFQ
MNQSSLTLLMAVLVLLTAVLLAFHAAPARPQPAYVALLACAAALFVALMVVCNRHSFRQD
SMWVVSYVVLGILAAVQVGGALAANPRSPSVGLWCPVFFVYITYTLLPIRMRAAVFSGLG
LSTLHLILAWQLNHGDAFLWKQLGANMLLFLCTNVIGICTHYPAEVSQRQAFQETRGYIQ
ARLHLQHENRQQERLLLSVLPQHVAMEMKEDINTKKEDMMFHKIYIQKHDNVSILFADIE
GFTSLASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHC
CVEMGVDMIEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHME
AGGRAGRIHITRATLQYLNGDYEVEPGRGGERNAYLKEQHIETFLILGASQKRKEEKAML
AKLQRTRANSMEGLMPRWVPERAFSRTKDSKAFRQMGIDDSSKDNRGAQDALNPEDEVDE
FLGRAIDARSIDQLRKDHVRRFLLTFQREDLEKKYSRKVDPRFGAYVACALLVFCFICFI
QLLVFPHSTLLLGIYASIFLLLLITVLTCAVYSCGSLFPKALQRLSRSIVRSRAHSTAVG
IFSVLLVFTSAIANMFTCNHTPIRTCAARMLNVTPADITACHLQQLNYSLGLDAPLCEGT
APTCSFPEYFVGNMLLSLLASSVFLHISSIGKLAMIFVLGLIYLVLLLLGPPATIFDNYD
LLLGVHGLASSNETFDGLDCPAAGRVALKYMTPVILLVFALALYLHAQQVESTARLDFLW
KLQATGEKEEMEELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASIA
NFSEFYVELEANNEGVECLRLLNEIIADFDEIISEERFRQLEKIKTIGSTYMAASGLNAS
TYDQAGRSHITALADYAMRLMEQMKHINEHSFNNFQMKIGLNMGPVVAGVIGARKPQYDI
WGNTVNVSSRMDSTGVPDRIQVTTDLYQVLAAKGYQLECRGVVKVKGKGEMTTYFLNGGP
PS
NT seq 3789 nt NT seq  +upstreamnt  +downstreamnt
atgtgctggtgtggtgcctgccccggtgctcgggagtggacttttcagttcctcccagac
ctcctttgcttattgacacaggcactcgagcttgtaaccaccaagaaatcagtgcttttt
agggaagaggtgaatgttgaagtgtactgctttggagtccggcagatctgggttagaatc
ttggttcccacacatccgtggctgcttgatgtagggcgagttacccgcctgcttctgtct
cggtttcctcacctgctgaatggggatcccgtcgtcctcctccatacttttatcatgtcc
tggtttagtggcctcctggtccccaaggtggatgaacggaaaacagcctggggtgaacgc
aatgggcagaagcgtccacgccgtgggactcggaccagcggcttctgcacaccgcgctat
atgagctgcctccgggatgcacagccccccagccccacccctgcagctcctcctcggtgc
ccctggcaggatgagactttcatgcggagaggtggcccgggcaaggagccggggctgcgg
gcggtggccctcggctttgaggacactgaggcgatggcggcggtcggggcagccgaggtg
gcacccgacgtggcagcccggggtaggcggtcttgctggcgccgtctggcccaggtgttc
cagtccaagcagttccgctcggccaagctggagcgcctgtaccagcggtacttctttcag
atgaaccagagcagcctgacgctgctgatggccgtgctggtgctgctgacggccgtgctg
ctagcctttcatgctgcacctgcccgccctcagcctgcctatgtggccctactggcctgt
gccgccgccctcttcgtagcgctcatggtggtgtgtaaccggcacagcttccgccaggac
tccatgtgggtggtgagctatgtggtgctgggcatcctggcagccgtgcaggttgggggt
gccctggcagccaacccccgcagcccctctgtgggcctctggtgccccgtgttttttgtc
tacatcacctacacgctcctacccatccgcatgcgggcggctgtcttcagtggcctgggc
ctctccaccctgcatctgatcttggcctggcagctcaaccatggtgatgccttcctctgg
aagcagcttggtgccaacatgctgctgttcctctgcaccaacgtcattggcatctgcaca
cactatccagctgaggtgtctcagcgccaggcctttcaggagacccgtggttacatccag
gcccggctgcacctgcagcatgagaatcggcagcaggaacggctgctgctatcagtgttg
ccccagcacgttgccatggagatgaaagaagatatcaacacaaagaaagaagacatgatg
ttccacaagatctacatacagaagcatgacaatgtcagcatcctgtttgcagacattgaa
ggcttcaccagcctggcatcccagtgcactgcgcaggagctggtcatgaccctgaacgag
ctctttgcccggtttgacaaactggctgcggaaaatcattgcctgaggatcaagatctta
ggggactgttactactgtgtgtcggggctgccggaagcccgagcagaccatgcccactgc
tgtgtggagatgggggtggacatgatcgaggccatctcgctggtgcgtgaggtgacaggt
gtgaacgtgaacatgcgcgtgggcatccacagcgggcgtgtgcactgtggcgtccttggt
ctgcggaaatggcaattcgatgtgtggtccaatgacgtgactctggccaaccacatggag
gcggggggccgggccggccgcatccatatcactcgggccacactgcagtacctgaatggg
gattatgaggtggagccaggccgtggtggtgagcgtaatgcatacctcaaggagcagcat
attgagaccttcctcatcctgggagccagccagaaacggaaagaggagaaggccatgctg
gccaagctgcagcgtacacgggccaactccatggaaggactgatgccacgctgggtgcct
gagcgcgccttttcccggaccaaggactccaaggctttccgccagatgggcattgatgat
tccagcaaagacaaccggggtgcccaagatgccctgaaccctgaggatgaggtagatgag
ttcctgggccgtgccatcgatgcccgcagcatcgatcaactacggaaggaccatgtgcgc
cgcttcctgctcaccttccagagagaggatcttgaaaagaagtactcgcggaaggtggac
ccccgcttcggagcctacgtagcctgtgcgctgttggtcttctgcttcatctgctttatc
caactcctcgtcttcccacattcaactctgcttcttgggatctatgccagtatcttcctg
ctgttgctgatcactgtgctgacctgtgccgtgtactcctgtggctctctcttccccaag
gccctgcaacgcctttcccgcagcattgtccgttctcgggcacacagcactgcggttggc
atcttttcagtcttgcttgtgttcacctctgccatcgccaacatgttcacctgtaaccac
acccccatacggacttgtgcagcccggatgctgaatgtaacacctgctgacatcactgcc
tgccacctgcagcagctcaattactctctgggcctggatgctcccctgtgtgagggcacc
gcacccacttgcagcttccctgagtacttcgttgggaacatgctgctgagtctcttggcc
agctctgtcttcctacacatcagtagcatcgggaagttggcaatgatctttgtcctcggg
ctcatctatttggtgctgcttctgctgggccccccagccaccatctttgacaactatgac
ctgctgcttggtgtccatggcttggcttcttccaatgagactttcgacgggctggactgc
ccagctgcagggagggtagcactcaaatacatgacccccgtgattctgctggtgtttgct
ctggcgctgtatctgcatgcccagcaggtggaatcaactgctcgtctggacttcctctgg
aaactgcaggcaacaggggagaaggaggagatggaggagctgcaggcatacaaccgaagg
ctgctccataacattctgcccaaggacgtggctgcccacttcctggcccgggagcgccgg
aacgatgagctctactatcagtcgtgtgagtgtgtggccgtcatgtttgcctccattgcc
aacttttctgagttctatgtggagctggaggcaaacaatgagggcgtcgagtgcctgcgg
ctgctcaacgaaatcatcgctgactttgatgagatcatcagcgaggagcggttccggcag
ctggagaagatcaagacgattggtagcacctacatggctgcctcagggctgaatgccagc
acctatgatcaagcgggccgctcccatatcactgccctggctgactatgccatgcggctc
atggaacagatgaagcacatcaacgagcactccttcaacaatttccagatgaagattggg
ctgaacatgggcccagtcgtggcaggcgtcattggggctcggaaaccacagtatgacatc
tgggggaacacagtgaatgtctctagccgtatggacagcacgggggtccctgaccgaatc
caggtgaccacggacttgtaccaggttctagctgccaagggctaccagctggagtgtcga
ggggtggtcaaggtgaagggcaagggggagatgaccacctacttcctcaatgggggcccc
cccagttag

KEGG   Felis catus (domestic cat): 101094148Help
Entry
101094148         CDS       T02385                                 

Gene name
ADCY7
Definition
(RefSeq) adenylate cyclase type 7 isoform X1
  KO
K08047  adenylate cyclase 7 [EC:4.6.1.1]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00230  Purine metabolism
fca01100  Metabolic pathways
fca01522  Endocrine resistance
fca04015  Rap1 signaling pathway
fca04020  Calcium signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04024  cAMP signaling pathway
fca04062  Chemokine signaling pathway
fca04072  Phospholipase D signaling pathway
fca04114  Oocyte meiosis
fca04211  Longevity regulating pathway
fca04213  Longevity regulating pathway - multiple species
fca04261  Adrenergic signaling in cardiomyocytes
fca04270  Vascular smooth muscle contraction
fca04371  Apelin signaling pathway
fca04540  Gap junction
fca04611  Platelet activation
fca04713  Circadian entrainment
fca04714  Thermogenesis
fca04723  Retrograde endocannabinoid signaling
fca04724  Glutamatergic synapse
fca04725  Cholinergic synapse
fca04727  GABAergic synapse
fca04750  Inflammatory mediator regulation of TRP channels
fca04911  Insulin secretion
fca04912  GnRH signaling pathway
fca04913  Ovarian steroidogenesis
fca04914  Progesterone-mediated oocyte maturation
fca04915  Estrogen signaling pathway
fca04916  Melanogenesis
fca04918  Thyroid hormone synthesis
fca04921  Oxytocin signaling pathway
fca04923  Regulation of lipolysis in adipocytes
fca04925  Aldosterone synthesis and secretion
fca04926  Relaxin signaling pathway
fca04927  Cortisol synthesis and secretion
fca04928  Parathyroid hormone synthesis, secretion and action
fca04934  Cushing syndrome
fca04970  Salivary secretion
fca04971  Gastric acid secretion
fca04972  Pancreatic secretion
fca04976  Bile secretion
fca05032  Morphine addiction
fca05163  Human cytomegalovirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05200  Pathways in cancer
fca05414  Dilated cardiomyopathy (DCM)
Module
fca_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    101094148 (ADCY7)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101094148 (ADCY7)
   04371 Apelin signaling pathway
    101094148 (ADCY7)
   04020 Calcium signaling pathway
    101094148 (ADCY7)
   04072 Phospholipase D signaling pathway
    101094148 (ADCY7)
   04024 cAMP signaling pathway
    101094148 (ADCY7)
   04022 cGMP-PKG signaling pathway
    101094148 (ADCY7)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101094148 (ADCY7)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101094148 (ADCY7)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101094148 (ADCY7)
   04062 Chemokine signaling pathway
    101094148 (ADCY7)
  09152 Endocrine system
   04911 Insulin secretion
    101094148 (ADCY7)
   04923 Regulation of lipolysis in adipocytes
    101094148 (ADCY7)
   04912 GnRH signaling pathway
    101094148 (ADCY7)
   04913 Ovarian steroidogenesis
    101094148 (ADCY7)
   04915 Estrogen signaling pathway
    101094148 (ADCY7)
   04914 Progesterone-mediated oocyte maturation
    101094148 (ADCY7)
   04921 Oxytocin signaling pathway
    101094148 (ADCY7)
   04926 Relaxin signaling pathway
    101094148 (ADCY7)
   04918 Thyroid hormone synthesis
    101094148 (ADCY7)
   04928 Parathyroid hormone synthesis, secretion and action
    101094148 (ADCY7)
   04916 Melanogenesis
    101094148 (ADCY7)
   04925 Aldosterone synthesis and secretion
    101094148 (ADCY7)
   04927 Cortisol synthesis and secretion
    101094148 (ADCY7)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101094148 (ADCY7)
   04270 Vascular smooth muscle contraction
    101094148 (ADCY7)
  09154 Digestive system
   04970 Salivary secretion
    101094148 (ADCY7)
   04971 Gastric acid secretion
    101094148 (ADCY7)
   04972 Pancreatic secretion
    101094148 (ADCY7)
   04976 Bile secretion
    101094148 (ADCY7)
  09156 Nervous system
   04724 Glutamatergic synapse
    101094148 (ADCY7)
   04727 GABAergic synapse
    101094148 (ADCY7)
   04725 Cholinergic synapse
    101094148 (ADCY7)
   04723 Retrograde endocannabinoid signaling
    101094148 (ADCY7)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101094148 (ADCY7)
  09149 Aging
   04211 Longevity regulating pathway
    101094148 (ADCY7)
   04213 Longevity regulating pathway - multiple species
    101094148 (ADCY7)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101094148 (ADCY7)
   04714 Thermogenesis
    101094148 (ADCY7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101094148 (ADCY7)
  09165 Substance dependence
   05032 Morphine addiction
    101094148 (ADCY7)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    101094148 (ADCY7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101094148 (ADCY7)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101094148 (ADCY7)
   05163 Human cytomegalovirus infection
    101094148 (ADCY7)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101094148 (ADCY7)
Enzymes [BR:fca01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     101094148 (ADCY7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc DUF1053 AC_N
Motif
Other DBs
NCBI-GeneID: 101094148
NCBI-ProteinID: XP_019675287
UniProt: M3X5P3
Position
E2
AA seq 1080 aa AA seqDB search
MPAKGRYFLNEGEEGPNQDVLYEKYRLTSQHGPLLLTLLLVAVTACVALIVIAFVCGDPS
GHQTVLGTTFFTLAVFVVLYVLVYVECLVRRWLRASALLIWVCLMMLGYVLVFDSWIKTT
HMGAQVPFFLFIVFVVYTLLPFSMQGAVVAGAVSSISHLLVIGTLMEAFTTPSVHAGLQL
LANAVIFLCGNLTGAFHKHQMQDASRDLFTYTVKCIQIRRKLRVKKRQQENLLLSVLPAH
ISMGMKLAIIERLKERGDRRYMPDNNFHSLYVKRHQNVSILYADIVGFTRLASDCSPKEL
VVMLNELFGKFDQIAKANECMRIKILGDCYYCVSGLPVSLPTHARNCVKMGLDMCEAIKQ
VREATGVDISMRVGIHSGNVLCGVIGLRKWQYDVWSHDVSLANRMEAAGVPGRVHITEAT
LNHLDKAYEVEDGHGQQRDPHLKEMNIHTYLVIDPRSQQPPPPSQHLPKPKGDVALKMRA
SVRMTRYLESWGAARPFAHLNHRESVSSNETPIPNGRRPKAIPLRRHRAPDRSASPKGRS
EDDSYDEEILSAIEGLSSTRPCCSKSDDFYTFGSIFLEKGFEREYRLAPIPRVRHYFACA
SLVFVCILLVHVLLLPRMAALGVSFGLVACVLGLVLGLCFAHEFLRCCPARGTLQAISER
VETQPLLRLSLAILTIGSLLSIAIVNLPLMPFPALRQPAGNQSLADGDVSSRELAPCKLL
PYYTCSCILAFVACSVFLRMSLELKVVLLTVALVAYLVLFNISPCWQWDCCSHSLANLTK
TNGTLSSPFCLWKDPKAMINFYLVLFYVTLIMLSRQIDYYCRLDCLWKKKFKKEHEEFET
MENVNRLLLENVLPAHVAAHFIGDKLNEDWYHQSYDCVCVMFASVPDFKVFYTECDVNKE
GLECLRLLNEIISDFDELLLKPKFSSVEKIKTIGSTYMAAVGLSVPSGSENQDLERQHAH
IGIMVEFSIALMSKLDGINRHSFNSFRLRVGINHGPVIAGVIGARKPQYDIWGNTVNVAS
RMESTGELGKIQVTEETCTILQGLGYSCECRGLINVKGKGELRTYFVCTDTAKFQGLGLN
NT seq 3243 nt NT seq  +upstreamnt  +downstreamnt
atgccggccaaggggcgctacttccttaacgagggcgaggagggcccgaaccaggacgtg
ctctacgagaagtaccgtctcaccagtcagcacgggccgctgctgctcacgctcctgttg
gtggctgtcactgcctgcgtcgccctcatcgtcatcgccttcgtctgcggggacccctct
ggacaccagactgtcctggggacgaccttcttcacacttgctgtgtttgtggttctctac
gtgctggtctatgttgagtgcctcgtccggcggtggctcagggcctcggcgctgctcatc
tgggtctgccttatgatgctgggctatgtgctggtgttcgactcatggataaagacaacc
cacatgggggcacaggtgcccttcttcctcttcattgtgttcgtggtgtacacgctgctg
cccttcagcatgcagggggccgtcgtggcgggggcagtctccagcatctcccacctcctc
gttatcgggactctgatggaggccttcacgacgcccagtgtccatgcagggctgcagctg
ctggccaacgctgtcatcttcctgtgtgggaatctcacgggcgccttccacaagcaccag
atgcaggacgcctcccgagacctcttcacctacaccgtcaagtgcatccagatccgtcgt
aaactgcgcgtcaagaagcgtcagcaggagaacctgctgctgtcggtgctgcccgcccac
atctccatgggcatgaagctggccatcatcgagcggctcaaggagcgcggggaccgccgc
tacatgcccgacaacaacttccacagcctgtacgtcaagcggcaccagaacgtcagcatc
ctctatgccgacatcgtgggcttcacacggctggccagcgactgctcccccaaagagttg
gtggtgatgctgaacgagctcttcggcaagttcgaccagatcgccaaggccaatgagtgt
atgcggatcaagatcctgggcgactgctattactgtgtgtcgggcctgcccgtatccctg
cccacccatgcccggaactgtgtgaagatggggctggacatgtgtgaggccattaagcag
gtgcgagaggccacaggtgtggacatcagcatgcgtgtgggcatccactcggggaacgtg
ctgtgtggtgtcattgggctgcgcaagtggcagtacgacgtgtggtcccacgacgtgtct
ctggccaacaggatggaggcggctggagtccctggccgggtgcacatcacagaggccacg
ctgaaccacctggacaaggcgtatgaggtggaggacgggcacgggcagcagcgggacccc
cacctgaaggagatgaacatccacacctacctggtcatcgacccccggagccagcagccg
cccccgcccagccagcacctccccaagcccaagggggatgtggccctgaagatgagggcg
tccgtgcgcatgacccgctacctcgagtcctggggggccgcacggccctttgcacacctc
aaccaccgcgagagcgtgagcagcaacgagacccctatccccaacggacggaggcccaag
gccattcccctgcggcgccaccgggcccctgacaggagtgcatcccccaaggggaggtct
gaggacgactcctacgatgaggagatcctctcggccatcgaggggcttagctccacgagg
ccctgctgctccaagtctgatgacttctacacctttgggtccatcttcctggagaagggc
tttgagcgagagtaccgcctggcgcccatcccccgggtccgccactatttcgcctgcgcc
agcctcgtcttcgtctgcatcctgctcgttcacgtcctgctcttgcccaggatggcggcc
ctgggtgtgtccttcgggctggtggcctgtgtgctggggctggtgctaggcctgtgcttt
gcccacgagttcctgaggtgctgccctgcccgagggacactgcaggccatctccgagagg
gtggagacccagcccctgctgcggctgtccctggccatcctgaccattggcagtctgctc
agcatcgccatcgtcaacctgccgctgatgcctttcccggccctgaggcagcctgcaggc
aaccagagcttggcggatggagatgtgagcagcagggagctggccccgtgcaagctcctc
ccgtattacacctgcagctgcatcctggcctttgtcgcctgctccgtcttcctgcggatg
agcctggagctgaaggtggtgctgctgacggtggccctggtggcctacctggtgctcttc
aacatctccccgtgctggcagtgggactgctgcagccacagcctggccaacctcaccaag
accaacggcaccctcagctccccgttctgtctgtggaaggacccgaaggcaatgatcaat
ttctacctggttttgttttacgtcaccctcatcatgctctccagacagattgactattac
tgccgcttggattgcttgtggaagaagaagttcaaaaaggaacacgaggagtttgaaacc
atggagaacgtgaaccgcctccttctggagaacgtcttgccagcccacgtggccgcacac
ttcattggtgacaagttaaatgaggactggtaccatcagtcctacgactgcgtgtgtgtc
atgtttgcgtcggtgccggacttcaaagtcttctacacggagtgcgacgtcaacaaggag
gggctggagtgcctgcgtctgctgaacgagatcatctccgacttcgacgagctgctccta
aagcccaagttcagcagtgtggagaagatcaagaccattggcagcacgtacatggcagcc
gtggggctcagcgtcccctcagggtctgagaaccaggacctggagcggcagcacgcgcac
atcggcatcatggtggagttcagcatcgccctgatgagcaagctggacggcatcaaccgg
cactccttcaactccttccgcctgcgagtcggcataaaccacgggcctgtgatcgctgga
gtgatcggggcacgaaagcctcagtatgatatctggggaaacacggtcaacgtcgccagc
cgaatggagagcaccggagaacttggcaagatccaggttactgaggagacctgcaccatc
ctccagggactaggttattcttgcgagtgccggggactgattaacgtcaaaggcaaaggc
gagctgaggacttactttgtctgcacagacacggcaaagttccaagggttgggactgaat
tga

KEGG   Felis catus (domestic cat): 101094327Help
Entry
101094327         CDS       T02385                                 

Gene name
ADCY2
Definition
(RefSeq) adenylate cyclase type 2 isoform X1
  KO
K08042  adenylate cyclase 2 [EC:4.6.1.1]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00230  Purine metabolism
fca01100  Metabolic pathways
fca01522  Endocrine resistance
fca04015  Rap1 signaling pathway
fca04020  Calcium signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04024  cAMP signaling pathway
fca04062  Chemokine signaling pathway
fca04072  Phospholipase D signaling pathway
fca04114  Oocyte meiosis
fca04211  Longevity regulating pathway
fca04213  Longevity regulating pathway - multiple species
fca04261  Adrenergic signaling in cardiomyocytes
fca04270  Vascular smooth muscle contraction
fca04371  Apelin signaling pathway
fca04540  Gap junction
fca04611  Platelet activation
fca04713  Circadian entrainment
fca04714  Thermogenesis
fca04723  Retrograde endocannabinoid signaling
fca04724  Glutamatergic synapse
fca04725  Cholinergic synapse
fca04727  GABAergic synapse
fca04750  Inflammatory mediator regulation of TRP channels
fca04911  Insulin secretion
fca04912  GnRH signaling pathway
fca04913  Ovarian steroidogenesis
fca04914  Progesterone-mediated oocyte maturation
fca04915  Estrogen signaling pathway
fca04916  Melanogenesis
fca04918  Thyroid hormone synthesis
fca04921  Oxytocin signaling pathway
fca04922  Glucagon signaling pathway
fca04923  Regulation of lipolysis in adipocytes
fca04925  Aldosterone synthesis and secretion
fca04926  Relaxin signaling pathway
fca04927  Cortisol synthesis and secretion
fca04928  Parathyroid hormone synthesis, secretion and action
fca04934  Cushing syndrome
fca04970  Salivary secretion
fca04971  Gastric acid secretion
fca04972  Pancreatic secretion
fca04976  Bile secretion
fca05032  Morphine addiction
fca05163  Human cytomegalovirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05200  Pathways in cancer
fca05414  Dilated cardiomyopathy (DCM)
Module
fca_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    101094327 (ADCY2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101094327 (ADCY2)
   04371 Apelin signaling pathway
    101094327 (ADCY2)
   04020 Calcium signaling pathway
    101094327 (ADCY2)
   04072 Phospholipase D signaling pathway
    101094327 (ADCY2)
   04024 cAMP signaling pathway
    101094327 (ADCY2)
   04022 cGMP-PKG signaling pathway
    101094327 (ADCY2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101094327 (ADCY2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101094327 (ADCY2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101094327 (ADCY2)
   04062 Chemokine signaling pathway
    101094327 (ADCY2)
  09152 Endocrine system
   04911 Insulin secretion
    101094327 (ADCY2)
   04922 Glucagon signaling pathway
    101094327 (ADCY2)
   04923 Regulation of lipolysis in adipocytes
    101094327 (ADCY2)
   04912 GnRH signaling pathway
    101094327 (ADCY2)
   04913 Ovarian steroidogenesis
    101094327 (ADCY2)
   04915 Estrogen signaling pathway
    101094327 (ADCY2)
   04914 Progesterone-mediated oocyte maturation
    101094327 (ADCY2)
   04921 Oxytocin signaling pathway
    101094327 (ADCY2)
   04926 Relaxin signaling pathway
    101094327 (ADCY2)
   04918 Thyroid hormone synthesis
    101094327 (ADCY2)
   04928 Parathyroid hormone synthesis, secretion and action
    101094327 (ADCY2)
   04916 Melanogenesis
    101094327 (ADCY2)
   04925 Aldosterone synthesis and secretion
    101094327 (ADCY2)
   04927 Cortisol synthesis and secretion
    101094327 (ADCY2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101094327 (ADCY2)
   04270 Vascular smooth muscle contraction
    101094327 (ADCY2)
  09154 Digestive system
   04970 Salivary secretion
    101094327 (ADCY2)
   04971 Gastric acid secretion
    101094327 (ADCY2)
   04972 Pancreatic secretion
    101094327 (ADCY2)
   04976 Bile secretion
    101094327 (ADCY2)
  09156 Nervous system
   04724 Glutamatergic synapse
    101094327 (ADCY2)
   04727 GABAergic synapse
    101094327 (ADCY2)
   04725 Cholinergic synapse
    101094327 (ADCY2)
   04723 Retrograde endocannabinoid signaling
    101094327 (ADCY2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101094327 (ADCY2)
  09149 Aging
   04211 Longevity regulating pathway
    101094327 (ADCY2)
   04213 Longevity regulating pathway - multiple species
    101094327 (ADCY2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101094327 (ADCY2)
   04714 Thermogenesis
    101094327 (ADCY2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101094327 (ADCY2)
  09165 Substance dependence
   05032 Morphine addiction
    101094327 (ADCY2)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    101094327 (ADCY2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101094327 (ADCY2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101094327 (ADCY2)
   05163 Human cytomegalovirus infection
    101094327 (ADCY2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101094327 (ADCY2)
Enzymes [BR:fca01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     101094327 (ADCY2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc DUF1053 AC_N HNOBA
Motif
Other DBs
NCBI-GeneID: 101094327
NCBI-ProteinID: XP_023095417
Ensembl: ENSFCAG00000015101
Position
A1
AA seq 1097 aa AA seqDB search
MWREAMRRRRYLRDRAEAAAAAAAAAAGGGDGLQRSRDWLYESYYCMSQQHPLIVFLLLI
VMGACLALLAVFFALRLEVEDHVAFLITVPTALAIFFAIFILVCIESVFKKLLRLFSLVI
WMCLVAMGYLFMCFGGTVSPWDQVSFFLFIIFVVYTMLPFNMRDAIIASVLTASSHTVVL
SICLSATPGAKEHLVWQILANVIIFICGNLAGAYHKHLMELALQQTYQDTCNCIKSRIKL
EFEKRQQERLLLSLLPAHIAMEMKAEIIQRLQGPKAGQMENTNNFHNLYVKRHTNVSILY
ADIVGFTRLASDCSPGELVHMLNELFGKFDQIAKENECMRIKILGDCYYCVSGLPISLPN
HAKNCVKMGLDMCEAIKKVRDATGVDINMRVGVHSGNVLCGVIGLQKWQYDVWSHDVTLA
NHMEAGGVPGRVHISSVTLEHLNGAYKVEEGDGDIRDPYLKQHLVKTYFVINPKGERRSP
HLFRPRHTLDGAKMRASVRMTRYLESWGAAKPFAHLHHRDSMTTENGKISTTDVPMGQHN
FQNRTLRTKSQKKRFEEELNERMIQAIDGINAQKQWLKSEDIQRISLLFYNKILEKEYRA
TALPAFKYYVTCACLILFCIFIVQILVLPKTSILGISFGAAFLLLACILFVCFAGQLLQC
SKKASASLLWLLKSSSIIADRPWPRVSLTVLTTAIILTMAVFNMFFLSDPEEAILPTANT
SNTSLSALNNQAVILRAQNLFFLPYFIYSCILGLISCSVFLRVNYELKMLIMMAALVGYN
TILLHTHAHVLDDYSQVLFERPGIWKDLKTMGSVSLFIFFITLLVLGRQNEYYCRLDFLW
KNKFKKEREEIETMENLNRVLLENVLPAHVAEHFLARSLKNEELYHQSYDCVCVMFASIP
DFKEFYTESDVNKEGLECLRLLNEIIADFDDLLSKPKFSGVEKIKTIGSTYMAATGLSAV
PSQEHTQEPERQYMHIGTMVEFAFALVGKLDAINKHSFNDFKLRVGINHGPVIAGVIGAQ
KPQYDIWGNTVNVASRMDSTGVLDKIQVTEETSLILQTLGYTCTCRGIINVKGKGELKTY
FVNTEMSRSLSQSNVAS
NT seq 3294 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgggaggcgatgcggcgccgccgctacctgcgggaccgcgccgaggcggcggct
gcggcggcggcggcggcggcgggcggcggcgacgggctgcagcggtcccgggactggctg
tacgagtcctactactgcatgagccagcagcacccgctcatcgtcttcctgctgctcatc
gtcatgggcgcctgcctcgccctgctcgccgtcttcttcgcgctccggctggaagtcgaa
gaccacgtggcgtttttaataacagtcccaactgccctggcgatcttctttgcgatattc
atcctcgtgtgcatcgagtccgtgtttaagaagctgctacgccttttctctttggtgata
tggatgtgtctggtggccatggggtacttgttcatgtgctttggaggcaccgtctccccc
tgggatcaggtgtccttcttcctcttcattatcttcgtggtatacaccatgctccccttc
aacatgcgagacgccatcatcgccagcgtgctcacggcctcctcccacaccgtcgtgctg
agcatctgcctgtccgcaacgcccggggccaaggagcacctggtctggcagatcctggcc
aacgtgatcattttcatctgtgggaacctggcgggagcgtaccacaagcacctcatggaa
cttgctctgcagcagacataccaggacacgtgcaattgcatcaagtcccggatcaagctg
gaatttgaaaagcgtcagcaggagcgtctcctgctgtctctgttgccggctcacatagcc
atggagatgaaagctgagatcatccagaggctgcagggccccaaagccggccaaatggaa
aacacaaacaactttcacaacctgtatgttaagcgacacaccaatgtgagtatcctgtac
gcagacatcgttggcttcacccggttggccagtgactgctccccaggagagctggtccac
atgctgaacgaactctttggaaagttcgatcaaattgcaaaggagaatgagtgcatgaga
ataaaaattttgggagactgctactactgcgtgtccggactccccatatctctcccgaac
catgccaagaattgtgtgaaaatgggactggatatgtgtgaagccataaagaaagtgagg
gacgccaccggcgtggatatcaacatgcgcgtcggagtgcattctgggaacgtcctctgc
ggcgtgatcggtctgcagaagtggcagtatgacgtgtggtcacatgacgttaccttagcc
aatcacatggaagccggaggggttcctggacgtgttcacatttcttctgtcaccttggaa
cacttgaatggcgcttataaagtggaggaaggagatggtgacatcagagacccatattta
aaacagcacctggtgaaaacctactttgtaatcaaccccaagggggaacgacggagtcct
cacctcttcagacctcgccacaccctcgatggagccaagatgagggcttccgtccgcatg
acccggtacctggagtcctggggagcagccaagccctttgcacacctgcatcaccgagat
agcatgaccacggagaacggcaagatcagcaccacggatgtgccaatgggtcagcataat
tttcaaaaccgtaccttaagaaccaagtcgcaaaagaagagatttgaggaagaattaaat
gaaaggatgattcaagcaattgatggaattaatgcacaaaagcagtggctcaagtctgaa
gacattcagagaatctcgctcctgttctacaataaaatactagaaaaagaataccgagcc
accgcactgccagcgttcaagtattacgtgacctgcgcgtgtctcatattgttctgcatt
tttatcgtgcagattctggtattacccaagacgtccattctcgggatctcctttggagcc
gcgtttctcttgcttgcctgtatccttttcgtctgctttgctggacagcttttgcaatgc
agcaagaaggcctccgcctctctcctgtggctgctgaagtcgtccagcatcatcgcggac
cggccctggccacgggtctccctcacggtcctcaccactgccatcatcctgaccatggcc
gtgttcaacatgtttttcctgagcgacccagaggaagccattcttccgactgccaacaca
tcaaacacaagtctttctgccttaaacaatcaggcagtgattctgcgtgcacagaatttg
tttttcctcccgtactttatctacagctgcattctgggactgatttcctgctcggttttc
ctgcgggtgaattacgagttgaaaatgctgatcatgatggcggcgttggtaggctacaac
accatccttctccacactcacgcccacgtcctggacgactacagccaggtcttatttgag
agaccaggcatttggaaagacctgaagaccatgggctcagtgtctctctttatatttttc
atcacactgcttgttctgggtagacagaatgaatattactgtaggttagacttcttgtgg
aagaacaagttcaaaaaagagcgggaggagatagaaaccatggagaacttgaaccgcgtg
ctgctggagaacgtgctgcccgcgcacgtggccgaacatttcctggcccggagcctgaag
aacgaggagttgtaccaccagtcctacgactgtgtctgtgtcatgtttgcttccattccg
gatttcaaggaattctacacagaatcggatgtgaacaaggagggcttggaatgccttcgg
ctcctgaacgagatcatcgccgactttgatgatctgctgtccaagccgaaattcagtgga
gttgaaaagatcaagaccatcggcagcacgtatatggccgcgaccggtctgagcgccgtg
cccagccaggagcatacccaggagcccgagaggcagtacatgcatatcggcaccatggtg
gagtttgcctttgccctggtggggaagctggacgctatcaacaaacactccttcaatgac
ttcaagctgcgagtgggtattaaccatgggcctgtaatagccggtgtgattggagctcag
aagccacaatacgatatctggggcaacaccgtgaatgtggccagcaggatggacagcacc
ggcgtgctggacaaaatacaggtcactgaggagacaagcctcatcctccagaccctgggg
tacacgtgcacatgtcgaggaataatcaatgtgaaaggcaagggggagctgaagacgtac
tttgtaaacacagaaatgtcaaggtccctttcccagagcaacgtggcatcctga

KEGG   Felis catus (domestic cat): 101095942Help
Entry
101095942         CDS       T02385                                 

Gene name
ADCY9
Definition
(RefSeq) adenylate cyclase type 9
  KO
K08049  adenylate cyclase 9 [EC:4.6.1.1]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00230  Purine metabolism
fca01100  Metabolic pathways
fca01522  Endocrine resistance
fca04015  Rap1 signaling pathway
fca04020  Calcium signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04024  cAMP signaling pathway
fca04062  Chemokine signaling pathway
fca04072  Phospholipase D signaling pathway
fca04114  Oocyte meiosis
fca04211  Longevity regulating pathway
fca04213  Longevity regulating pathway - multiple species
fca04261  Adrenergic signaling in cardiomyocytes
fca04270  Vascular smooth muscle contraction
fca04371  Apelin signaling pathway
fca04540  Gap junction
fca04611  Platelet activation
fca04713  Circadian entrainment
fca04714  Thermogenesis
fca04723  Retrograde endocannabinoid signaling
fca04724  Glutamatergic synapse
fca04725  Cholinergic synapse
fca04727  GABAergic synapse
fca04750  Inflammatory mediator regulation of TRP channels
fca04911  Insulin secretion
fca04912  GnRH signaling pathway
fca04913  Ovarian steroidogenesis
fca04914  Progesterone-mediated oocyte maturation
fca04915  Estrogen signaling pathway
fca04916  Melanogenesis
fca04918  Thyroid hormone synthesis
fca04921  Oxytocin signaling pathway
fca04923  Regulation of lipolysis in adipocytes
fca04925  Aldosterone synthesis and secretion
fca04926  Relaxin signaling pathway
fca04927  Cortisol synthesis and secretion
fca04928  Parathyroid hormone synthesis, secretion and action
fca04934  Cushing syndrome
fca04961  Endocrine and other factor-regulated calcium reabsorption
fca04962  Vasopressin-regulated water reabsorption
fca04970  Salivary secretion
fca04971  Gastric acid secretion
fca04972  Pancreatic secretion
fca04976  Bile secretion
fca05032  Morphine addiction
fca05163  Human cytomegalovirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05200  Pathways in cancer
fca05414  Dilated cardiomyopathy (DCM)
Module
fca_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    101095942 (ADCY9)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101095942 (ADCY9)
   04371 Apelin signaling pathway
    101095942 (ADCY9)
   04020 Calcium signaling pathway
    101095942 (ADCY9)
   04072 Phospholipase D signaling pathway
    101095942 (ADCY9)
   04024 cAMP signaling pathway
    101095942 (ADCY9)
   04022 cGMP-PKG signaling pathway
    101095942 (ADCY9)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101095942 (ADCY9)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101095942 (ADCY9)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101095942 (ADCY9)
   04062 Chemokine signaling pathway
    101095942 (ADCY9)
  09152 Endocrine system
   04911 Insulin secretion
    101095942 (ADCY9)
   04923 Regulation of lipolysis in adipocytes
    101095942 (ADCY9)
   04912 GnRH signaling pathway
    101095942 (ADCY9)
   04913 Ovarian steroidogenesis
    101095942 (ADCY9)
   04915 Estrogen signaling pathway
    101095942 (ADCY9)
   04914 Progesterone-mediated oocyte maturation
    101095942 (ADCY9)
   04921 Oxytocin signaling pathway
    101095942 (ADCY9)
   04926 Relaxin signaling pathway
    101095942 (ADCY9)
   04918 Thyroid hormone synthesis
    101095942 (ADCY9)
   04928 Parathyroid hormone synthesis, secretion and action
    101095942 (ADCY9)
   04916 Melanogenesis
    101095942 (ADCY9)
   04925 Aldosterone synthesis and secretion
    101095942 (ADCY9)
   04927 Cortisol synthesis and secretion
    101095942 (ADCY9)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101095942 (ADCY9)
   04270 Vascular smooth muscle contraction
    101095942 (ADCY9)
  09154 Digestive system
   04970 Salivary secretion
    101095942 (ADCY9)
   04971 Gastric acid secretion
    101095942 (ADCY9)
   04972 Pancreatic secretion
    101095942 (ADCY9)
   04976 Bile secretion
    101095942 (ADCY9)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    101095942 (ADCY9)
   04961 Endocrine and other factor-regulated calcium reabsorption
    101095942 (ADCY9)
  09156 Nervous system
   04724 Glutamatergic synapse
    101095942 (ADCY9)
   04727 GABAergic synapse
    101095942 (ADCY9)
   04725 Cholinergic synapse
    101095942 (ADCY9)
   04723 Retrograde endocannabinoid signaling
    101095942 (ADCY9)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101095942 (ADCY9)
  09149 Aging
   04211 Longevity regulating pathway
    101095942 (ADCY9)
   04213 Longevity regulating pathway - multiple species
    101095942 (ADCY9)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101095942 (ADCY9)
   04714 Thermogenesis
    101095942 (ADCY9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101095942 (ADCY9)
  09165 Substance dependence
   05032 Morphine addiction
    101095942 (ADCY9)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    101095942 (ADCY9)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101095942 (ADCY9)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101095942 (ADCY9)
   05163 Human cytomegalovirus infection
    101095942 (ADCY9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101095942 (ADCY9)
Enzymes [BR:fca01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     101095942 (ADCY9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc DUF512 AC_N DUF1053 zf-C2HC_2
Motif
Other DBs
NCBI-GeneID: 101095942
NCBI-ProteinID: XP_023102435
Ensembl: ENSFCAG00000024244
Position
E3
AA seq 1352 aa AA seqDB search
MASPPHQQLLQHHSTEVSCDSSGDSNSVRVKINPKQLSSNSHPKHCKYSISSSCSSSGDS
AGVPRRVGAGGRLRRQKKLPQLFERASSRWWDPKFDSVNLEEACMERCFPQTQRRFRYAL
FYIGFACLLWSIYFGVHMRSRLIVMVAPALCFLVVCGGFFLFTFTKVYARHYVWTSLVLT
LLVFALTLAAQFQVLTPLSGRVDSSNHTLATKPTDTCLSQVGSFSMCIEVLFLLYTVMHL
PLYLSLCLGVAYSVLFETFGYHFRDKDCFPPPEAGAPHWELLSRALLHVCIHAIGIHLFI
MSQVRSRSTFLKVGQSIMHGKDLEVEKALKERMIHSVMPRIIADDLMKQGDEESENSVKR
HATSSPKNRKKKSSIQKAPIAFRPFKMQQIDEVSILFADIVGFTKMSANKSAHALVGLLN
DLFGRFDRLCEETKCEKISTLGDCYYCVAGCPEPRADHAYCCIEMGLGMIRAIEQFCQEK
KEMVNMRVGVHTGTVLCGILGMRRFKFDVWSNDVNLANLMEQLGVAGKVHISEATAKYLD
DRYEMEDGRVTERLGQSVVADQLKGLKTYLIAGQRAKESRCSCSEALLSGYEVIDGSRVS
SGPRGQGTASPGSVSDLAQTVKTFDNLKTCPSCGITFAPKSEAGAEGGAVQNGCQEEHKN
STKAPGAPNSKTQNGLLSPPHEEKLTNSQTSLCEILQEKGRWAGVSLDQSALLPLRFKNI
REKTDAHFVDVIKEDSLMKDYFFKPPINQFSLNFLDQELERSYRTSYQEEVIKNSPVKTF
ASATFSSLLDVFLSTTVFLILSITCFLKYGAASMPPPPAALAVFGAALLLEVLSLVVSVR
MVFFLEDVMACTKRLLERIAGWLPRHFIGAILVSLPALAVYSHVTSEFDTDIHFTVFAGS
AILTAVVHYCNFCQLSSWMRSSLATVVGAGPLLLLYVSLCPDSSVVISHLDVGQNFSSKG
NPCNSSLPRDGRAASLIGQEGVLVFFLLLLLVWFLNREFEVSYRLHYHGDVEADLHRTKI
QSMRDQADWLLRNIIPYHVAEQLKVSQTYSKNHDSGGVIFASIVNFSEFYEENYEGGKEC
YRVLNELIGDFDELLSRPGYGSIEKIKTIGATYMAASGLNGAQCRDGSHPQEHLQVLFEF
AKEMMRVVDDFNSNMLWFNFKLRVGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDSTG
VECRIQVSEESYRVLSKMGYDFDYRGTVNVKGKGQMKTYLYPKCTDSGAVPQHQLSISPD
IRVQVDGSIGRSPTDEIANLVPSVQSADKTPPGSENNVQARDGHLSSKRPWKEPVKAEER
CRFGKAIEKSDCEEAGAEEASELTRLNVSESV
NT seq 4059 nt NT seq  +upstreamnt  +downstreamnt
atggcttccccgccccaccagcagctgctgcagcaccacagcacggaggtgagctgtgac
tccagcggagacagcaacagcgtgagggtcaaaatcaaccccaagcagctgtcctccaac
agccaccccaagcactgcaagtacagcatctcctccagctgtagcagctctggggactcg
gcgggcgtcccccggagagtgggcgctggaggccgcctgcgcaggcagaagaagctgccc
cagctgttcgagagggcctccagccggtggtgggaccccaagttcgactcggtgaacctg
gaggaggcttgcatggagcgctgcttcccgcagacccagcgccgcttccggtatgcgctc
ttctacatcggcttcgcctgccttctgtggagcatctattttggggtccacatgcggtcc
cgactgattgtcatggtagcccctgctctgtgcttcctcgtcgtgtgtgggggctttttt
ctgtttaccttcaccaaggtgtatgcccggcattacgtgtggacctctctggttctcacc
ctcctggtgtttgccctgaccctggctgcccagtttcaggttctgacgcctctctcagga
cgtgttgacagctccaatcacaccctcgccaccaagcccacagacacttgtttgtctcaa
gtggggagcttttccatgtgcatcgaagtgctctttttgctctacaccgtcatgcactta
cctttgtacttgagcttgtgtttgggagtggcctattctgttctctttgagacctttggc
tatcacttccgagacaaagactgctttcccccacccgaagcaggggccccacactgggag
ctgctgagcagagccctgctccacgtctgcattcacgccattgggatccacctctttatc
atgtcccaggtgagatccaggagcacctttctcaaggtgggacagtcaattatgcacgga
aaggatctggaagtggaaaaagccctgaaagagaggatgattcattctgtgatgccaaga
atcatagctgatgacttgatgaaacagggggatgaggagagcgagaattctgtcaaaagg
cacgccacctccagccccaagaacaggaagaaaaagtcttccatacagaaagcccctata
gcgttccgcccttttaaaatgcagcagatcgatgaagtcagtattttatttgcagatatc
gtgggcttcaccaagatgagtgccaataagtccgctcacgccctggtgggtctcctcaac
gatctgttcggtcgctttgaccggttgtgtgaagagaccaagtgtgagaaaatcagcacc
ctgggagactgctactattgcgtggcagggtgtccagagccccgggctgaccatgcctac
tgctgcattgagatgggcttgggcatgatcagagccatcgagcagttctgccaggagaag
aaagagatggtgaacatgcgtgtcggggttcacacggggaccgtcttgtgtggcattttg
ggcatgaggaggttcaaattcgatgtgtggtccaatgatgtgaacttggccaatctcatg
gagcagctgggagttgctggcaaggttcacatttctgaggccactgcaaaatacctagat
gatcggtacgaaatggaagacgggagagtgactgaacggcttggccagagcgttgttgct
gatcagttgaaaggtttgaagacatacctgatagcgggtcagagagcgaaggagtctcgt
tgcagctgttcagaggccttgctttctggctatgaggtcattgacggctcacgggtgtcc
tcaggccctaggggacaggggacagcatcgccagggagtgtcagtgacttggcgcagact
gtcaaaacctttgataaccttaagacctgcccttcgtgcggaatcacgttcgcccccaaa
tcggaagctggtgcagaaggaggagcggtccaaaacggctgtcaagaggagcataaaaac
agcaccaaggctcctggagctcctaattccaaaactcaaaatggacttctgagtcctccc
cacgaagagaagctcaccaacagtcagacctccctgtgtgagatcttacaggaaaaggga
aggtgggcaggagtgagcttggaccagtcagctctccttccactgagattcaagaacatc
cgggagaaaacagacgcccattttgttgatgttatcaaagaagacagcctgatgaaggat
tattttttcaagccacccatcaatcagttcagcttgaacttcctggatcaggagcttgag
cgatcctatcggaccagctatcaagaagaggttataaagaattctcccgtgaagactttt
gccagcgccaccttcagctccctcctggatgtgtttctgtcgacgacagtgtttctgatt
ctgtccatcacctgcttcctgaagtacggggctgcttccatgcctcccccgcccgccgcc
ctggccgtcttcggtgccgccctgctgctggaggtgctgtccctcgtggtctccgtcagg
atggtgtttttcctggaggatgtgatggcttgtaccaagcgcctgctggagcggatagct
ggctggctcccgcgccatttcattggggccatcctggtgtcactccctgctctcgccgtc
tattcacatgtcacctctgaatttgacaccgacatacacttcaccgtgttcgcgggctcc
gccatcctgaccgctgtcgtgcactactgtaacttctgccagctcagctcctggatgagg
tcctccttagccaccgtcgtcggggctgggccgctgctcctgctctacgtctccctttgc
ccggacagttccgtagtaatttcacacctggatgtgggacagaatttcagttccaagggg
aatccgtgcaacagttccttgccgcgtgacggcagagcagccagcctgattggccaggag
ggggttcttgtcttctttctcctgctcttgttggtctggttcctgaatcgagaattcgag
gtcagctaccgcctgcactaccacggggacgtggaggcggacctccaccgcaccaagatc
cagagcatgagggaccaagctgactggctgctgagaaacatcatcccctaccacgtggct
gagcagctgaaggtgtcccagacctactccaagaaccacgacagcgggggcgtcatcttt
gccagcatcgtcaacttcagcgagttctacgaggagaactacgaggggggcaaggagtgc
taccgcgtcctcaacgagctcatcggggacttcgacgagctcctgagcaggccgggctac
ggcagcatcgagaagatcaagaccatcggagccacgtacatggctgcgtcaggtctgaac
ggcgcgcagtgccgggacggcagccacccgcaggagcacctgcaggtcctgtttgagttc
gccaaggagatgatgcgcgtggtcgacgacttcaacagcaacatgctgtggttcaacttc
aagctcagggtgggcttcaaccacgggccgctcacggcgggggtcatcggcaccaccaag
ctgctctacgacatctggggcgacaccgtcaacatcgccagcaggatggacagcacgggg
gtggagtgccggatccaggtgagcgaggagagctaccgcgtcctgagcaagatgggctat
gacttcgactaccgagggacggtgaacgtcaagggcaagggccagatgaagacctacctg
tacccaaagtgcacggacagcggggccgtgccgcagcaccagctgtccatctccccggac
atccgagtccaggtggacggcagcatcgggcggtctcccacggacgagatcgccaacctg
gtgccttctgtccagagcgcggacaagacgcctccgggttccgaaaacaacgtgcaggcc
agggatggtcacctgtcctctaagaggccctggaaggagcctgtcaaagccgaagaaagg
tgtcgatttggcaaagccatagagaaaagcgactgtgaagaagcgggcgctgaagaagcc
agcgagctcaccaggctcaacgtttctgagagcgtgtga

KEGG   Felis catus (domestic cat): 101097735Help
Entry
101097735         CDS       T02385                                 

Gene name
ADCY4
Definition
(RefSeq) adenylate cyclase type 4
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00230  Purine metabolism
fca01100  Metabolic pathways
fca01522  Endocrine resistance
fca04015  Rap1 signaling pathway
fca04020  Calcium signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04024  cAMP signaling pathway
fca04062  Chemokine signaling pathway
fca04072  Phospholipase D signaling pathway
fca04114  Oocyte meiosis
fca04211  Longevity regulating pathway
fca04213  Longevity regulating pathway - multiple species
fca04261  Adrenergic signaling in cardiomyocytes
fca04270  Vascular smooth muscle contraction
fca04371  Apelin signaling pathway
fca04540  Gap junction
fca04611  Platelet activation
fca04713  Circadian entrainment
fca04714  Thermogenesis
fca04723  Retrograde endocannabinoid signaling
fca04724  Glutamatergic synapse
fca04725  Cholinergic synapse
fca04727  GABAergic synapse
fca04742  Taste transduction
fca04750  Inflammatory mediator regulation of TRP channels
fca04911  Insulin secretion
fca04912  GnRH signaling pathway
fca04913  Ovarian steroidogenesis
fca04914  Progesterone-mediated oocyte maturation
fca04915  Estrogen signaling pathway
fca04916  Melanogenesis
fca04918  Thyroid hormone synthesis
fca04921  Oxytocin signaling pathway
fca04923  Regulation of lipolysis in adipocytes
fca04925  Aldosterone synthesis and secretion
fca04926  Relaxin signaling pathway
fca04927  Cortisol synthesis and secretion
fca04928  Parathyroid hormone synthesis, secretion and action
fca04934  Cushing syndrome
fca04970  Salivary secretion
fca04971  Gastric acid secretion
fca04972  Pancreatic secretion
fca04976  Bile secretion
fca05032  Morphine addiction
fca05163  Human cytomegalovirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05200  Pathways in cancer
fca05414  Dilated cardiomyopathy (DCM)
Module
fca_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    101097735 (ADCY4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101097735 (ADCY4)
   04371 Apelin signaling pathway
    101097735 (ADCY4)
   04020 Calcium signaling pathway
    101097735 (ADCY4)
   04072 Phospholipase D signaling pathway
    101097735 (ADCY4)
   04024 cAMP signaling pathway
    101097735 (ADCY4)
   04022 cGMP-PKG signaling pathway
    101097735 (ADCY4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101097735 (ADCY4)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101097735 (ADCY4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101097735 (ADCY4)
   04062 Chemokine signaling pathway
    101097735 (ADCY4)
  09152 Endocrine system
   04911 Insulin secretion
    101097735 (ADCY4)
   04923 Regulation of lipolysis in adipocytes
    101097735 (ADCY4)
   04912 GnRH signaling pathway
    101097735 (ADCY4)
   04913 Ovarian steroidogenesis
    101097735 (ADCY4)
   04915 Estrogen signaling pathway
    101097735 (ADCY4)
   04914 Progesterone-mediated oocyte maturation
    101097735 (ADCY4)
   04921 Oxytocin signaling pathway
    101097735 (ADCY4)
   04926 Relaxin signaling pathway
    101097735 (ADCY4)
   04918 Thyroid hormone synthesis
    101097735 (ADCY4)
   04928 Parathyroid hormone synthesis, secretion and action
    101097735 (ADCY4)
   04916 Melanogenesis
    101097735 (ADCY4)
   04925 Aldosterone synthesis and secretion
    101097735 (ADCY4)
   04927 Cortisol synthesis and secretion
    101097735 (ADCY4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101097735 (ADCY4)
   04270 Vascular smooth muscle contraction
    101097735 (ADCY4)
  09154 Digestive system
   04970 Salivary secretion
    101097735 (ADCY4)
   04971 Gastric acid secretion
    101097735 (ADCY4)
   04972 Pancreatic secretion
    101097735 (ADCY4)
   04976 Bile secretion
    101097735 (ADCY4)
  09156 Nervous system
   04724 Glutamatergic synapse
    101097735 (ADCY4)
   04727 GABAergic synapse
    101097735 (ADCY4)
   04725 Cholinergic synapse
    101097735 (ADCY4)
   04723 Retrograde endocannabinoid signaling
    101097735 (ADCY4)
  09157 Sensory system
   04742 Taste transduction
    101097735 (ADCY4)
   04750 Inflammatory mediator regulation of TRP channels
    101097735 (ADCY4)
  09149 Aging
   04211 Longevity regulating pathway
    101097735 (ADCY4)
   04213 Longevity regulating pathway - multiple species
    101097735 (ADCY4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101097735 (ADCY4)
   04714 Thermogenesis
    101097735 (ADCY4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101097735 (ADCY4)
  09165 Substance dependence
   05032 Morphine addiction
    101097735 (ADCY4)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    101097735 (ADCY4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101097735 (ADCY4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101097735 (ADCY4)
   05163 Human cytomegalovirus infection
    101097735 (ADCY4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101097735 (ADCY4)
Enzymes [BR:fca01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     101097735 (ADCY4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc DUF1053 AC_N CD52
Motif
Other DBs
NCBI-GeneID: 101097735
NCBI-ProteinID: XP_023111950
Ensembl: ENSFCAG00000005600
Position
B3
AA seq 1036 aa AA seqDB search
MARLFSPRPPPSEDLFYETYYSLSQQYPLLLLLLVIVLCALLALLAVASASGRELASDPG
FLTTVLCALGGFSLLLGLASREQRLQRWTRPLSGLVWAALLGLGHGFLFTGGLVSAWDQV
SFFLFVIFTVYAMLPLGMRDAAAAGLASSLSHLLVLGLYLGPQPDSKPALLPQLAANAVL
FLCGNVAGAYHKALMERALRATFREALSSLHSRRRLDTEKKHQEHLLLSILPAYLAREMK
AEIMARLQAGQGSRPESTNNFHSLYVKRHQGVSVLYADIVGFTRLASECSPKELVLMLNE
LFGKFDQIAKEHECMRIKILGDCYYCVSGLPLSLPDHAINCVRMGLDMCRAIRKLRAATG
VDINMRVGVHSGSVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHITGATLALLAG
AYAVEDAAMEHRDPYLRELGEPTYLVIDPRAEEEDEKGTAGGLLSSLEGPKMRPSLLMTR
YLESWGAAKPFAHLSHLESPVSTSTPLPEKALASFSPQWSLDRSRTPRGLDDDLDTGDAK
FFQVIEQLNSQKQWRQSKDFNPLTLYFRKKELEKEYRLSALPAFKYYAACTFLVFLSNFI
IQMLVTNRPPACIPKSAEPQHKPPSCPGSCLPTSALHFLLQFFLPAASNCPFGTLNVSSM
AFNISWELPGSLPLISVPYSMHCCVLGFLSCSLFLHMSFELKLLLLLLWLGASCSLFLHS
HAWLSDCLIARLYPDPSDSRPGVLKEPKLMGAISFFIFFFTLLVLARQNEYYCRLDFLWK
KKLRQEQEETETMENLTRLLLENVLPAHVAPQFIGQNRRNEDLYHQSYECVCVLFASVPD
FKEFYSESNINHEGLECLRLLNEIIADFDELLSKPKFSGVEKIKTIGSTYMAATGLNATS
GQDAQQDAERSCSHLGTMVEFAVALGSKLDVINKHSFNNFRLRVGLNHGPVVAGVIGAQK
PQYDIWGNTVNVASRMESTGVLGKIQVTEETARVLQSLGYTCYSRGIIKVKGKGQLCTYF
LNTDLARTGPPSATLG
NT seq 3111 nt NT seq  +upstreamnt  +downstreamnt
atggcccgcctcttcagcccccggccgccccccagcgaagacctcttctacgaaacctac
tacagcctgagccagcagtacccgctgctgctactgctgctggtgatcgtgctctgcgcg
ctcctggcgctgctggctgtcgcctccgccagcggccgggagctagcttcagacccaggc
ttcctgaccactgtgctgtgcgcgctgggtggcttctcgctgctcctgggcctggcttcc
cgggagcaacgactgcagcgctggacacgtcccctgtcgggcctcgtatgggcagcgcta
ctcgggctaggccacggcttcctgttcactgggggcctggtgagcgcctgggaccaggtg
tcctttttcctctttgtcatcttcaccgtgtatgccatgttgcccttgggtatgcgggat
gccgctgctgcgggccttgcctcatcgctctcccacttgctggtccttgggctgtacctt
gggcctcagccggactcaaagccggcgctgctgccacagctggcagcgaacgcggtgttg
ttcctgtgcgggaacgtggcgggagcgtatcacaaggcgctgatggaacgcgcgctgcgc
gccacgttccgcgaggcacttagctccctgcactcgcgccggcggctggacaccgagaag
aagcaccaggaacaccttctcttgtccatccttcctgcctacttggcccgagagatgaag
gcagagatcatggcacgactgcaggctggacaggggtcacggccagaaagcaccaacaac
ttccacagcctctatgtcaagaggcaccagggagtcagtgtgctgtatgctgacatcgtg
ggcttcacccggctggccagtgagtgctctcctaaggagttggtgctcatgctcaacgag
ctctttggcaagttcgaccagatcgccaaggagcatgaatgcatgcggatcaagatcctg
ggagactgttactactgtgtctctgggctaccgctctccctgccagaccacgccatcaac
tgcgtgcgcatggggctggacatgtgccgggccatcaggaagctccgggcagccactggc
gtggacatcaacatgcgtgtgggcgtgcattcgggcagtgtgctctgcggagtcattggg
ctgcagaagtggcagtatgatgtctggtcccatgatgtcacactggccaaccacatggag
gcgggtggcgtgccaggacgagtgcatattacaggggctaccctggccctgctggcaggg
gcttatgctgtggaggatgcagccatggaacaccgggacccataccttcgggagctaggg
gagcctacctacctagtcatcgatccccgggctgaggaggaggatgagaagggcactgca
ggagggttgctgtcctctctcgagggccccaagatgcgtccgtcgctgctgatgacccgc
tacctggagtcctggggcgccgccaagccttttgcccatctgagccacctagagagccct
gtgtccacctctacccctctcccggagaaggccctggcttccttcagcccccagtggagc
ctggaccggagccgtaccccccgggggctagatgatgacctggacactggggatgccaag
ttcttccaggtcatcgaacagctcaactctcagaaacagtggaggcagtcaaaggacttc
aacccactgacactgtacttcagaaagaaggaactggagaaagagtaccgactctctgcc
ctccccgccttcaaatactatgcagcctgcaccttcctggttttcctttccaatttcatc
atccagatgctggtgacaaacaggcccccagcctgcatccctaagtcagctgaaccccag
cacaagccaccatcgtgcccagggagctgcctgcccacctcagctcttcacttccttctg
cagttcttcttaccggcagcatcaaactgcccttttgggactctcaatgtgtcctccatg
gctttcaacatctcctgggagctccctgggtccctgcctctcatcagcgtcccctactct
atgcactgctgcgtgctggggttcctgtcctgctccctctttttgcacatgagcttcgag
ctgaagttgctgctgctcctgctatggctgggggcctcctgctccctcttcctgcactcc
cacgcctggctgtccgactgcctcatcgcccgcctctatccggatccctcggactccagg
ccaggggtgctgaaggagcccaaactgatgggagctatctccttcttcatcttcttcttc
accctcctggtcctggctcggcagaatgagtattactgccggctggacttcctgtggaag
aagaagctgcggcaggagcaggaggagacagagaccatggagaacctgactcggctgctg
ttggagaatgtgctccctgcacatgtggccccccagttcattggccagaaccggcgcaac
gaggacctctaccaccagtcctatgagtgtgtctgtgtcctgttcgcctcagttccagac
ttcaaggagttttactctgagtccaacataaaccacgagggtctagagtgtctgcggctg
ctcaatgagataattgctgattttgatgagctgctctcaaagcccaagtttagcggggtg
gagaagatcaaaaccatcggtagcacctacatggcagctacaggcttaaatgccacctcc
ggacaggacgcacagcaggacgctgagcgcagctgcagccaccttggcaccatggtggag
tttgcggtggctcttggatcaaagctggacgtcatcaataagcactctttcaacaacttc
cgcttgcgtgtggggttgaatcacggacctgtagtggctggagtgatcggggcccagaag
ccgcagtatgacatctggggcaacacagtgaacgtggccagccgcatggagagtacagga
gtcctgggcaagatccaggtgaccgaagagacggcccgggtgctgcagtccttaggctac
acctgctacagccggggtatcatcaaggtcaaaggcaaagggcagctctgcacctacttt
ctgaacacagatttggcacgaactggacctccctcggccaccctaggctga

KEGG   Felis catus (domestic cat): 101100749Help
Entry
101100749         CDS       T02385                                 

Gene name
ADCY5
Definition
(RefSeq) adenylate cyclase type 5 isoform X2
  KO
K08045  adenylate cyclase 5 [EC:4.6.1.1]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00230  Purine metabolism
fca01100  Metabolic pathways
fca01522  Endocrine resistance
fca04015  Rap1 signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04024  cAMP signaling pathway
fca04062  Chemokine signaling pathway
fca04072  Phospholipase D signaling pathway
fca04114  Oocyte meiosis
fca04211  Longevity regulating pathway
fca04213  Longevity regulating pathway - multiple species
fca04261  Adrenergic signaling in cardiomyocytes
fca04270  Vascular smooth muscle contraction
fca04371  Apelin signaling pathway
fca04540  Gap junction
fca04611  Platelet activation
fca04713  Circadian entrainment
fca04714  Thermogenesis
fca04723  Retrograde endocannabinoid signaling
fca04724  Glutamatergic synapse
fca04725  Cholinergic synapse
fca04726  Serotonergic synapse
fca04727  GABAergic synapse
fca04728  Dopaminergic synapse
fca04750  Inflammatory mediator regulation of TRP channels
fca04911  Insulin secretion
fca04912  GnRH signaling pathway
fca04913  Ovarian steroidogenesis
fca04914  Progesterone-mediated oocyte maturation
fca04915  Estrogen signaling pathway
fca04916  Melanogenesis
fca04918  Thyroid hormone synthesis
fca04921  Oxytocin signaling pathway
fca04923  Regulation of lipolysis in adipocytes
fca04924  Renin secretion
fca04925  Aldosterone synthesis and secretion
fca04926  Relaxin signaling pathway
fca04927  Cortisol synthesis and secretion
fca04928  Parathyroid hormone synthesis, secretion and action
fca04934  Cushing syndrome
fca04970  Salivary secretion
fca04971  Gastric acid secretion
fca04972  Pancreatic secretion
fca04976  Bile secretion
fca05012  Parkinson disease
fca05030  Cocaine addiction
fca05031  Amphetamine addiction
fca05032  Morphine addiction
fca05034  Alcoholism
fca05163  Human cytomegalovirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05200  Pathways in cancer
fca05414  Dilated cardiomyopathy (DCM)
Module
fca_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    101100749 (ADCY5)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101100749 (ADCY5)
   04371 Apelin signaling pathway
    101100749 (ADCY5)
   04072 Phospholipase D signaling pathway
    101100749 (ADCY5)
   04024 cAMP signaling pathway
    101100749 (ADCY5)
   04022 cGMP-PKG signaling pathway
    101100749 (ADCY5)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101100749 (ADCY5)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101100749 (ADCY5)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101100749 (ADCY5)
   04062 Chemokine signaling pathway
    101100749 (ADCY5)
  09152 Endocrine system
   04911 Insulin secretion
    101100749 (ADCY5)
   04923 Regulation of lipolysis in adipocytes
    101100749 (ADCY5)
   04912 GnRH signaling pathway
    101100749 (ADCY5)
   04913 Ovarian steroidogenesis
    101100749 (ADCY5)
   04915 Estrogen signaling pathway
    101100749 (ADCY5)
   04914 Progesterone-mediated oocyte maturation
    101100749 (ADCY5)
   04921 Oxytocin signaling pathway
    101100749 (ADCY5)
   04926 Relaxin signaling pathway
    101100749 (ADCY5)
   04918 Thyroid hormone synthesis
    101100749 (ADCY5)
   04928 Parathyroid hormone synthesis, secretion and action
    101100749 (ADCY5)
   04916 Melanogenesis
    101100749 (ADCY5)
   04924 Renin secretion
    101100749 (ADCY5)
   04925 Aldosterone synthesis and secretion
    101100749 (ADCY5)
   04927 Cortisol synthesis and secretion
    101100749 (ADCY5)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101100749 (ADCY5)
   04270 Vascular smooth muscle contraction
    101100749 (ADCY5)
  09154 Digestive system
   04970 Salivary secretion
    101100749 (ADCY5)
   04971 Gastric acid secretion
    101100749 (ADCY5)
   04972 Pancreatic secretion
    101100749 (ADCY5)
   04976 Bile secretion
    101100749 (ADCY5)
  09156 Nervous system
   04724 Glutamatergic synapse
    101100749 (ADCY5)
   04727 GABAergic synapse
    101100749 (ADCY5)
   04725 Cholinergic synapse
    101100749 (ADCY5)
   04728 Dopaminergic synapse
    101100749 (ADCY5)
   04726 Serotonergic synapse
    101100749 (ADCY5)
   04723 Retrograde endocannabinoid signaling
    101100749 (ADCY5)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101100749 (ADCY5)
  09149 Aging
   04211 Longevity regulating pathway
    101100749 (ADCY5)
   04213 Longevity regulating pathway - multiple species
    101100749 (ADCY5)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101100749 (ADCY5)
   04714 Thermogenesis
    101100749 (ADCY5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101100749 (ADCY5)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    101100749 (ADCY5)
  09165 Substance dependence
   05030 Cocaine addiction
    101100749 (ADCY5)
   05031 Amphetamine addiction
    101100749 (ADCY5)
   05032 Morphine addiction
    101100749 (ADCY5)
   05034 Alcoholism
    101100749 (ADCY5)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    101100749 (ADCY5)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101100749 (ADCY5)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101100749 (ADCY5)
   05163 Human cytomegalovirus infection
    101100749 (ADCY5)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101100749 (ADCY5)
Enzymes [BR:fca01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     101100749 (ADCY5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AC_N Guanylate_cyc DUF1053 HNOBA TBK1_ULD PEN-2
Motif
Other DBs
NCBI-GeneID: 101100749
NCBI-ProteinID: XP_019695411
Ensembl: ENSFCAG00000000939
Position
C2
AA seq 1262 aa AA seqDB search
MSGSKSVSPPGYAAQTAAAPASRGGPEHRSAWGEADSRANGYPHAPGGSTRSCTKKPGGA
VTPQQQQQRLANRWRNDDDDDPPLSGDDPLAGGFGFSFRSKSAWQERGGDDCGRGSRRQR
RGAAGGGSTRAPPGGGGGGSAAAAAAAGGTEVRPRSVELGLEERRGKGRAADELEAGAGA
VEGDEGSGDGSSSAGSGAGPGSVLSLGACCLALLQIFRSKKFPSDKLERLYQRYFFRLNQ
SSLTMLMAVLVLVCLVMLAFHAARPPLQLPYLAVLAAAVGVILVMAVLCNRAAFHQDHMG
LACYALIAVVLAVQVVGLLLPQPRSASEGIWWTVFFIYTIYTLLPVRMRAAVLSGVLLSA
LHLAIALRTNAQDQFLLKQLVSNVLIFSCTNIVGVCTHYPAEVSQRQAFQETRECIQARL
HSQRENQQQERLLLSVLPRHVAMEMKADINAKQEDMMFHKIYIQKHDNVSILFADIEGFT
SLASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVE
MGMDMIEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGG
KAGRIHITKATLNYLNGDYEVEPGCGGERNAYLKEHSIETFLILRCTQKRKEEKAMIAKM
NRQRTNSIGHNPPHWGAERPFYNHLGGNQVSKEMKRMGFEDPKDKNAQESANPEDEVDEF
LGRAIDARSIDRLRSEHVRKFLLTFREPDLEKKYSKQVDDRFGAYVACASLVFLFICFVQ
ITIVPHSVFMLSFYLTCFLLLTLVVFVSVIYSCVKLFPAPLQTLSRKIVRSKTNSTLVGV
FTITLVFLSAFVNMFMCNSKDLFGCLADEHNISTSQVNACHVVESAVNYSLGDERGFCSS
PRPNCNFPEYFTYSVLLSLLACSVFLQISCIGKLVLMLAIELTYVLIVEVPRVTLFDNAD
LLVTANAIDFSNNGTSQCPEHATKVALKVVTPIIISVFVLALYLHAQQVESTARLDFLWK
LQATEEKEEMEELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASIAN
FSEFYVELEANNEGVECLRLLNEIIADFDEIISEDRFRQLEKIKTIGSTYMAASGLNDST
YDKVGKTHIKALADFAMKLMDQMKYINEHSFNNFQMKIGLNIGPVVAGVIGARKPQYDIW
GNTVNVASRMDSTGVPDRIQVTTDMYQVLAANTYQLECRGVVKVKGKGEMMTYFLNGGPP
LS
NT seq 3789 nt NT seq  +upstreamnt  +downstreamnt
atgtccggctccaaaagcgtaagccccccgggctacgcggcgcagacagcggcggcgccg
gcgtcccggggaggcccggaacatcgctcggcgtggggggaggccgattcccgcgccaat
ggctacccccacgcccccgggggttcgacccgcagctgcaccaagaaacccgggggggcg
gtgaccccgcagcagcagcagcagcgcctggctaatcgttggcgcaacgacgacgacgac
gatcctccgctgagtggtgacgaccctctggcggggggcttcggcttcagcttccgctcc
aaatctgcttggcaggagcgcggcggcgacgactgcggtcgcggcagccgccggcagcgg
cggggcgcggccggcgggggcagcacccgggcgccccctgggggcggcggtggcggctcg
gccgcggctgcggccgcagcgggcgggaccgaggtgcgccctcgctcggtggagctgggc
ctggaggagcggcgcggcaagggccgcgcggcggacgagctggaggccggtgccggtgcc
gtcgagggcgacgaagggtcaggggatggcagcagctcggccggctcaggcgcggggccc
ggctcagtgctgtcgctgggcgcctgctgcctggcgctgctgcagatattccgctccaag
aagttcccgtcggacaaactggagcggctgtaccagcgctacttcttccgtctgaaccag
agcagcctcactatgcttatggccgtgctggtgctcgtgtgcctcgtcatgttggccttc
cacgcggcgcggcccccgctccagctgccctacctggcagtgctggcggccgcggtgggt
gtcatccttgtcatggctgtgctctgtaaccgtgccgccttccaccaggaccacatgggc
ctggcctgctacgcgctcatcgccgtggtgctggctgtccaggtggtgggcctgctgctg
ccccagccgcgcagcgcctcggagggcatctggtggaccgtgttcttcatctacaccatc
tacacgttgctgcctgtgcgcatgcgggccgcggtactcagtggggtgctgctgtctgcc
ctccacctggccatcgccctgcgcaccaacgcccaggaccagttcctgctcaagcagctt
gtctccaatgtcctcattttctcctgcaccaacatcgtgggtgtctgcacccactacccg
gctgaggtctctcagagacaggccttccaggaaacccgggagtgcatccaggcacggctc
cactcacaacgggagaaccagcaacaggagcggctcctgctgtctgtcctgccccgtcat
gttgccatggagatgaaagcagacatcaatgccaagcaggaggatatgatgttccataag
atttacatccagaaacatgacaacgtgagcatcctgtttgctgacatcgagggcttcacc
agcctggcgtcccagtgcactgcccaggagctagtcatgaccctcaacgagctcttcgcc
cgcttcgacaagctggctgcggagaatcactgtttacgtattaagatcctgggggattgt
tattactgtgtctctgggctgcctgaagcgagggctgaccacgctcactgctgcgtggag
atgggcatggacatgattgaggccatctcgttggtccgggaggtgactggggtgaacgtg
aacatgcgcgtgggaattcacagtgggcgagtacactgcggtgtccttggtctcaggaag
tggcagttcgacgtctggtctaatgacgtcacgctggccaaccacatggaagctggaggc
aaggcagggcgcatccacatcaccaaggccacgctcaactacctgaatggtgactacgag
gtggagccaggctgtgggggcgagcgcaacgcctacctcaaggagcacagcattgagacc
ttcctcatcctgcgctgcacccagaagcggaaagaagaaaaggccatgatcgccaagatg
aatcgtcagagaaccaactccattgggcacaacccgcctcactggggggctgagcgtccc
ttctacaaccacctagggggcaaccaggtgtccaaggagatgaagcggatgggctttgaa
gaccccaaggacaagaacgcccaggaaagtgcaaaccccgaggatgaagtggacgaattt
ctgggccgtgccattgacgccaggagcatcgacaggctgcggtctgagcatgtccgcaag
ttcctcttgaccttcagggagcctgacttagagaagaagtactccaagcaggtggatgac
cgattcggtgcctatgtggcatgtgcctcgcttgtcttcctcttcatctgctttgtccag
atcaccatcgtgccccactcggtgttcatgttgagtttctacctgacctgtttcctgctg
ctgaccttggtggtgtttgtgtccgtgatttattcctgcgtgaagctcttcccggcccca
ctgcagaccctttccaggaagatcgtgcggtccaagactaacagcaccctggtcggagtg
ttcaccatcaccctggtgttcctgtcggcttttgtcaacatgttcatgtgtaactccaag
gacctgttcggctgcctggcggacgagcacaacatcagcaccagccaggtcaacgcgtgc
catgtggtggagtcggcagtcaactacagcctgggtgacgagcggggcttctgcagcagc
ccccggcccaactgcaacttccccgagtacttcacctacagcgtgctgctcagcctgctg
gcctgctccgtgttcctgcagatcagctgcattgggaagctggtgctcatgctggccatt
gagctcacatacgtgctcattgttgaggtgccccgcgtcacgctctttgacaacgccgac
ctgctggtcaccgccaacgccatagacttcagcaacaacgggacctcccagtgccctgag
catgcgaccaaggtggcgctgaaggtggtgacgcccatcatcatctcagtcttcgtgctg
gccctgtacctgcacgcccagcaagtagagtccaccgcccgcctggacttcctctggaaa
ctgcaggccacggaggaaaaggaggagatggaggagctgcaggcctacaaccggcggctg
ctgcacaacatcctgcccaaggatgtggccgcccacttcctggcccgcgagcgacgcaat
gatgagctctactaccagtcgtgtgagtgcgtggccgtcatgttcgcctccatcgccaac
ttctctgagttctacgtggagctggaggccaacaatgagggtgttgagtgcctgcgactg
ctcaatgagatcatcgccgactttgacgagatcatcagcgaggatcggttcaggcagctg
gaaaagatcaagaccattggcagcacctacatggctgcctcaggcctcaatgactctaca
tatgacaaggtgggcaagacccacatcaaagccctggctgactttgccatgaagctcatg
gaccaaatgaagtacatcaatgagcactccttcaacaacttccagatgaagatcgggctc
aatattggccccgtggtggctggggtgatcggggctcgcaagcctcagtacgacatctgg
ggcaatacggtgaacgtggccagccgcatggacagcaccggtgtgcctgaccgcatccag
gtcaccacagacatgtaccaggtgctggctgccaacacataccagctggagtgcaggggc
gtggtcaaggtcaagggcaaaggagagatgatgacctacttcctcaacggtgggcccccg
ctcagttag

KEGG   Felis catus (domestic cat): 101101375Help
Entry
101101375         CDS       T02385                                 

Gene name
ADCY1
Definition
(RefSeq) adenylate cyclase type 1
  KO
K08041  adenylate cyclase 1 [EC:4.6.1.1]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00230  Purine metabolism
fca01100  Metabolic pathways
fca01522  Endocrine resistance
fca04015  Rap1 signaling pathway
fca04020  Calcium signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04024  cAMP signaling pathway
fca04062  Chemokine signaling pathway
fca04072  Phospholipase D signaling pathway
fca04114  Oocyte meiosis
fca04211  Longevity regulating pathway
fca04213  Longevity regulating pathway - multiple species
fca04261  Adrenergic signaling in cardiomyocytes
fca04270  Vascular smooth muscle contraction
fca04371  Apelin signaling pathway
fca04540  Gap junction
fca04611  Platelet activation
fca04713  Circadian entrainment
fca04714  Thermogenesis
fca04720  Long-term potentiation
fca04723  Retrograde endocannabinoid signaling
fca04724  Glutamatergic synapse
fca04725  Cholinergic synapse
fca04727  GABAergic synapse
fca04750  Inflammatory mediator regulation of TRP channels
fca04911  Insulin secretion
fca04912  GnRH signaling pathway
fca04913  Ovarian steroidogenesis
fca04914  Progesterone-mediated oocyte maturation
fca04915  Estrogen signaling pathway
fca04916  Melanogenesis
fca04918  Thyroid hormone synthesis
fca04921  Oxytocin signaling pathway
fca04923  Regulation of lipolysis in adipocytes
fca04925  Aldosterone synthesis and secretion
fca04926  Relaxin signaling pathway
fca04927  Cortisol synthesis and secretion
fca04928  Parathyroid hormone synthesis, secretion and action
fca04934  Cushing syndrome
fca04970  Salivary secretion
fca04971  Gastric acid secretion
fca04972  Pancreatic secretion
fca04976  Bile secretion
fca05032  Morphine addiction
fca05142  Chagas disease (American trypanosomiasis)
fca05146  Amoebiasis
fca05163  Human cytomegalovirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05200  Pathways in cancer
fca05414  Dilated cardiomyopathy (DCM)
Module
fca_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    101101375 (ADCY1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101101375 (ADCY1)
   04371 Apelin signaling pathway
    101101375 (ADCY1)
   04020 Calcium signaling pathway
    101101375 (ADCY1)
   04072 Phospholipase D signaling pathway
    101101375 (ADCY1)
   04024 cAMP signaling pathway
    101101375 (ADCY1)
   04022 cGMP-PKG signaling pathway
    101101375 (ADCY1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101101375 (ADCY1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101101375 (ADCY1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101101375 (ADCY1)
   04062 Chemokine signaling pathway
    101101375 (ADCY1)
  09152 Endocrine system
   04911 Insulin secretion
    101101375 (ADCY1)
   04923 Regulation of lipolysis in adipocytes
    101101375 (ADCY1)
   04912 GnRH signaling pathway
    101101375 (ADCY1)
   04913 Ovarian steroidogenesis
    101101375 (ADCY1)
   04915 Estrogen signaling pathway
    101101375 (ADCY1)
   04914 Progesterone-mediated oocyte maturation
    101101375 (ADCY1)
   04921 Oxytocin signaling pathway
    101101375 (ADCY1)
   04926 Relaxin signaling pathway
    101101375 (ADCY1)
   04918 Thyroid hormone synthesis
    101101375 (ADCY1)
   04928 Parathyroid hormone synthesis, secretion and action
    101101375 (ADCY1)
   04916 Melanogenesis
    101101375 (ADCY1)
   04925 Aldosterone synthesis and secretion
    101101375 (ADCY1)
   04927 Cortisol synthesis and secretion
    101101375 (ADCY1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101101375 (ADCY1)
   04270 Vascular smooth muscle contraction
    101101375 (ADCY1)
  09154 Digestive system
   04970 Salivary secretion
    101101375 (ADCY1)
   04971 Gastric acid secretion
    101101375 (ADCY1)
   04972 Pancreatic secretion
    101101375 (ADCY1)
   04976 Bile secretion
    101101375 (ADCY1)
  09156 Nervous system
   04724 Glutamatergic synapse
    101101375 (ADCY1)
   04727 GABAergic synapse
    101101375 (ADCY1)
   04725 Cholinergic synapse
    101101375 (ADCY1)
   04720 Long-term potentiation
    101101375 (ADCY1)
   04723 Retrograde endocannabinoid signaling
    101101375 (ADCY1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101101375 (ADCY1)
  09149 Aging
   04211 Longevity regulating pathway
    101101375 (ADCY1)
   04213 Longevity regulating pathway - multiple species
    101101375 (ADCY1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101101375 (ADCY1)
   04714 Thermogenesis
    101101375 (ADCY1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101101375 (ADCY1)
  09165 Substance dependence
   05032 Morphine addiction
    101101375 (ADCY1)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    101101375 (ADCY1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101101375 (ADCY1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101101375 (ADCY1)
   05163 Human cytomegalovirus infection
    101101375 (ADCY1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101101375 (ADCY1)
   05142 Chagas disease (American trypanosomiasis)
    101101375 (ADCY1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101101375 (ADCY1)
Enzymes [BR:fca01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     101101375 (ADCY1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc AC_N DUF1053 HNOBA
Motif
Other DBs
NCBI-GeneID: 101101375
NCBI-ProteinID: XP_006929124
Ensembl: ENSFCAG00000011140
Position
A2
AA seq 903 aa AA seqDB search
MYGVFVRILAERSQRKAFLQARNCIEDRLRLEDENEKQERLLMSLLPRNVAMEMKEDFLK
PPERIFHKIYIQRHDNVSILFADIVGFTGLASQCTAQELVKLLNELFGKFDELATENHCR
RIKILGDCYYCVSGLTQPKTDHAHCCVEMGLDMIDTITSVAEATEVDLNMRVGLHTGRVL
CGVLGLRKWQYDVWSNDVTLANVMEAAGLPGKVHITKTTLACLNGDYEVEPGHGHERNSF
LKAHNIETFFIVPSHRRKIFPGLILSDIKPAKRMKFKTVCYLLVQLMHCRKMFKAEIPFS
NVLTCEDDDKRRALRTASEKLRNRSSFSANAVYTTPGTRVNRYIGRLLEARQTELEMADL
DFFTLKYKQAERERKYHQLQDEYFTSAVVLALVLAALFGLVYLLIIPQNLVLLLLLAFCI
CFLVACVLYLHVTRVQCFPGCLTIQIRTVLCIFVVVLIYSVAQGCVVGCLPWSWSSTPNG
SLVVLTPSGRNAVLPAAPCESAPHALLCGLVGTLPLAVFLRVSSLPKMILLFVLTTSYIL
VLELSGYTRAPGGGVASGRSFEPIMAILLFSCTLALHARQVDVKLRLDYLWAAQAEEERD
DMERVKLDNKRILFNLLPAHVAQHFLMSNPRNMDLYYQSYSQVGVMFASIPNFDDFYIEL
DGNNMGVECLRLLNEIIADFDELMDKDFYKDLEKIKTIGSTYMAAVGLAPTTGTKAKKGI
SSHLSTLADFAIEMFDVLDEINYQSYNDFVLRVGINVGPVVAGVIGARRPQYDIWGNTVN
VASRMDSTGVQGRIQVTEEVHRLLRRGTYRFVCRGKVSVKGKGEMLTYFLEGRTDGNGSQ
ARERKVCGYGRAGLQGRLGTGPPPVSSMAGLPVRAGMGALQGSGLPPCPHGQHLPPGAAG
KEA
NT seq 2712 nt NT seq  +upstreamnt  +downstreamnt
atgtatggggtgtttgtgcgcatcctggctgagcgctcccagcggaaagccttcctgcaa
gcccggaactgcatcgaagatcggctgaggctggaggatgagaacgagaagcaggagcgg
ctgctcatgagccttctgccccggaatgttgccatggagatgaaggaggacttcctgaag
ccccccgagaggattttccacaagatttacatccagcggcatgacaacgtgagcatcctc
tttgcggacattgtgggcttcacgggcctggcatcgcagtgcacggcacaggagctggtg
aagctcctcaacgagctgttcggcaagtttgatgaactggccacggagaatcactgtcgc
cgcatcaagatcctaggggactgttactactgtgtgtctggcctcacccagcccaagacc
gaccacgcccactgctgcgtggagatgggcctggacatgatcgacaccatcacgtctgtg
gccgaggccaccgaggtggacctgaacatgcgcgtggggctgcacacaggcagggtcctc
tgcggggtcctgggcctgcgcaagtggcagtacgacgtgtggtccaacgacgtgactctg
gccaacgtcatggaggcagccggcctacctgggaaggtccacatcacgaagacgacccta
gcgtgcctgaacggggactacgaggtggagccgggtcacggacatgagaggaacagtttt
ctgaaagctcacaacatcgagaccttctttatcgtgccgtcacatcggcggaagatattt
ccagggctgatcctctctgacataaaaccagccaagaggatgaagttcaagaccgtgtgc
tacctgctcgtgcagctgatgcactgtcggaagatgttcaaggcagagatcccgttctct
aacgtcctgacgtgtgaggacgacgacaagcggagggcgctgagaaccgcgtcggagaaa
ctgcgaaaccgctcttcgttctccgcaaacgccgtctacaccaccccgggcacgcgcgtc
aacaggtacatcggccgcctcctggaagcgcgccagacggagctggagatggcggacttg
gacttcttcaccctcaagtacaagcaggctgagcgggagcgcaagtaccaccagctccag
gacgagtattttaccagcgccgtcgttctggccctcgtcctggccgccttgttcggcctc
gtctacctgctcatcatcccacagaacctggtcctcctgctgctgctggccttctgtatc
tgcttcctggtggcctgcgtcttgtacctgcacgtcacccgggtccagtgttttccaggg
tgcctgacgattcagatccgtaccgtcttgtgtatcttcgtcgtggtcttaatctactcc
gtggcccaaggatgtgtggtgggctgcctgccctggtcctggagctccacccccaacggg
tccctggtggtcctgacgcccagcggccgcaacgccgtgctgcctgccgcgccctgtgag
tcggcgccccacgccctgctctgcggccttgtgggtaccctcccgctggctgtcttcctg
cgggtgtcctccctgcccaaaatgatcctgctctttgtgctcacgacgtcctacatcctg
gtcctggagctcagcggctacaccagggcccccgggggcggcgtggcgtcggggcgcagt
ttcgagccgatcatggccatcctgctgttttcctgcaccctggccctgcacgcccgtcag
gtggacgtcaagctgcggctggactacctctgggcagcacaggcagaggaggagagagat
gacatggagagggtgaagttggacaacaagaggattctcttcaacctcctgccggcccac
gtggctcagcacttcctcatgtccaacccccgcaacatggacctgtactaccagtcctac
tcacaggtgggcgtcatgtttgcttccatccccaacttcgacgacttctacatcgagctg
gacggcaacaacatgggggtggagtgtctgcgtctcctgaacgagatcatcgcagacttc
gacgagctcatggacaaagacttttacaaggacttggagaagatcaagaccatcgggagc
acctacatggccgctgtggggctggcgcccaccactgggaccaaggccaagaagggcatc
tcctcccacctgagcacactggctgacttcgccatcgagatgttcgacgtcctggatgaa
atcaactaccagtcttacaacgactttgtgctccgtgtgggcatcaacgtaggccctgtg
gtggccggggtgatcggggctcggaggccgcagtacgacatctgggggaacacagtcaac
gtggccagtcggatggacagcaccggcgtccagggcagaatccaggtgactgaggaggtt
caccggctgctgcgccgggggacctaccgcttcgtgtgccgcgggaaggtcagcgtcaag
ggcaagggtgagatgctgacgtacttcctggaaggcaggacggatggaaacggctcccaa
gccagggagcggaaagtgtgtggctacgggcgagccggcctccagggcagactgggcacg
ggcccacccccggtgtcctccatggccggcctcccggtcagagccgggatgggggctctg
cagggctcagggctccccccctgcccccacggccagcacctgccccccggagcagctggg
aaggaggcttag

DBGET integrated database retrieval system