KEGG   Felis catus (domestic cat): 101087625Help
Entry
101087625         CDS       T02385                                 

Gene name
GNA13
Definition
(RefSeq) guanine nucleotide-binding protein subunit alpha-13
  KO
K04639  guanine nucleotide-binding protein subunit alpha-13
Organism
fca  Felis catus (domestic cat)
Pathway
fca04022  cGMP-PKG signaling pathway
fca04071  Sphingolipid signaling pathway
fca04072  Phospholipase D signaling pathway
fca04270  Vascular smooth muscle contraction
fca04371  Apelin signaling pathway
fca04611  Platelet activation
fca04730  Long-term depression
fca04810  Regulation of actin cytoskeleton
fca04928  Parathyroid hormone synthesis, secretion and action
fca05163  Human cytomegalovirus infection
fca05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    101087625 (GNA13)
   04072 Phospholipase D signaling pathway
    101087625 (GNA13)
   04071 Sphingolipid signaling pathway
    101087625 (GNA13)
   04022 cGMP-PKG signaling pathway
    101087625 (GNA13)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101087625 (GNA13)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101087625 (GNA13)
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    101087625 (GNA13)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101087625 (GNA13)
  09156 Nervous system
   04730 Long-term depression
    101087625 (GNA13)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101087625 (GNA13)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    101087625 (GNA13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101087625 (GNA13)
   04031 GTP-binding proteins [BR:fca04031]
    101087625 (GNA13)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101087625 (GNA13)
  Exosomal proteins of colorectal cancer cells
   101087625 (GNA13)
GTP-binding proteins [BR:fca04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 4 (G12/13)
    101087625 (GNA13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-alpha Arf Gtr1_RagA FtsK_SpoIIIE
Motif
Other DBs
NCBI-GeneID: 101087625
NCBI-ProteinID: XP_003997148
Ensembl: ENSFCAG00000023383
UniProt: M3X9G7
Position
E1
AA seq 377 aa AA seqDB search
MADFLPSRSVLSVCFPGCVLTSGEAEQQRKSKEIDKCLSREKTYVKRLVKILLLGAGESG
KSTFLKQMRIIHGQDFDQRAREEFRPTIYSNVIKGMRVLVDAREKLHIPWGDDSNQVNGD
KMMAFDTRSSMAAQGMVESQVFLQYLPVIRALWADSGIQNAYDRRREFQLGESVKYFLDN
LDKLGEADYIPSQQDILLARRPTKGIHEYDFEIKNVPFKMVDVGGQRSERKRWFECFDSV
TSILFLVSSSEFDQVLMEDRLTNRLTESLNIFETIVNNRVFSNVSIILFLNKTDLLEEKV
RIVSIKDYFLEFEGDPHCLRDVQKFLVECFRNKRRDQQQKPLYHHFTTAINTENIRLVFR
DVKDTILHDNLKQLMLQ
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggcggacttcctgccgtcgcggtccgtgctgtccgtgtgcttccccggctgcgtgctc
acgagcggcgaggccgagcagcagcgcaagtccaaggagatcgacaaatgcctgtcccgg
gagaagacctacgtgaagcggctcgtgaagatcctgctgctgggcgcgggcgagagcggc
aagtccaccttcctgaagcagatgcggatcatccacgggcaggacttcgaccagcgcgcg
cgcgaggagttccgccccaccatctacagcaacgtgattaaaggtatgcgggtgctggtg
gacgcgcgtgagaagcttcatatcccgtggggagacgactcaaaccaagtcaacggggac
aagatgatggcatttgacacacggtcctccatggcggcccagggaatggtggaaagtcaa
gtgtttttacagtatctcccggtcatacgagcattgtgggcagacagcggcatacagaac
gcctatgaccggcgtcgagaatttcaactgggtgaatccgtaaaatatttcctggataac
ttggataaacttggagaagcagattacatcccatcacagcaagatattctgctggccaga
agacccaccaaaggcattcacgagtacgactttgaaattaaaaatgttcctttcaaaatg
gttgatgtaggtggtcagaggtcagaaagaaagcggtggtttgagtgctttgacagcgtg
acgtcgatacttttccttgtgtcctcaagcgaattcgaccaggtgcttatggaagatcga
ctgaccaaccgcctgacagagtctctgaacattttcgaaacgatcgtcaacaaccgggtt
ttcagcaacgtctccataatccttttcttaaacaagacagatttgcttgaggagaaggtg
cgaattgtgagcatcaaagactatttcttagaatttgaaggggatccccactgcttaaga
gacgtccaaaaattcctggtggaatgtttccggaacaagcggcgggaccagcagcagaag
cccctgtaccaccacttcaccaccgcgatcaacacggagaacatccgcctggttttccgc
gacgtcaaggatactattcttcatgacaacctcaagcagctcatgctgcagtga

KEGG   Felis catus (domestic cat): 101093316Help
Entry
101093316         CDS       T02385                                 

Gene name
GNA12
Definition
(RefSeq) guanine nucleotide-binding protein subunit alpha-12
  KO
K04346  guanine nucleotide-binding protein subunit alpha-12
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04071  Sphingolipid signaling pathway
fca04072  Phospholipase D signaling pathway
fca04270  Vascular smooth muscle contraction
fca04730  Long-term depression
fca04810  Regulation of actin cytoskeleton
fca04928  Parathyroid hormone synthesis, secretion and action
fca05163  Human cytomegalovirus infection
fca05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101093316 (GNA12)
   04072 Phospholipase D signaling pathway
    101093316 (GNA12)
   04071 Sphingolipid signaling pathway
    101093316 (GNA12)
   04022 cGMP-PKG signaling pathway
    101093316 (GNA12)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101093316 (GNA12)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    101093316 (GNA12)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101093316 (GNA12)
  09156 Nervous system
   04730 Long-term depression
    101093316 (GNA12)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101093316 (GNA12)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    101093316 (GNA12)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101093316 (GNA12)
   04031 GTP-binding proteins [BR:fca04031]
    101093316 (GNA12)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   101093316 (GNA12)
GTP-binding proteins [BR:fca04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 4 (G12/13)
    101093316 (GNA12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-alpha Arf Gtr1_RagA FtsK_SpoIIIE
Motif
Other DBs
NCBI-GeneID: 101093316
NCBI-ProteinID: XP_023102657
Position
E3
AA seq 382 aa AA seqDB search
MSGVVRTLSRCLLPAEAGGARERRAGGSGARDAEREARRRSRDIDAGLARERRAVRRLVK
ILLLGAGESGKSTFLKQMRIIHGREFDQKALLEFRDTIFDNILKGSRVLVDARDKLGIPW
QYSENEKHGMFLLAFENKAGLPVEPATFQLYVPALSALWRDSGIREAFSRRSEFQLGESV
KYFLDNLDRIGQLNYFPSKQDILLARKATKGIVEHDFVIKKIPFKMVDVGGQRSQRQKWF
QCFDGITSILFMVSSSEYDQVLMEDRRTNRLLEAMSIFETIVNNKLFFNVSIILFLNKTD
LLVEKVKTVSIKKHFPDFKGDPHRLEDVQRYLVQCFDRKRRNRTKPLFHHFTTAIDTENI
RFVFHAVKDTILQENLKDIMLQ
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgtccggcgtggtgcggaccctcagccgctgcctgctgccggccgaggccggcggggcc
cgcgagcgcagggcgggcggcagcggggcccgcgacgcggagcgcgaggcgcggcggcgc
agccgggacatcgacgcggggctggcccgcgagcggcgcgccgtgcggcgcctcgtcaag
atcctgctgctgggcgcgggcgagagcggcaagtccaccttcctcaagcagatgcgcatc
atccacggccgcgagttcgaccagaaggcgctgctcgagttccgcgacaccatcttcgac
aacatccttaagggctcacgggtcctcgtggatgcgcgagacaagctgggcatcccgtgg
cagtattcggaaaatgagaagcacggcatgtttctcctggcctttgagaacaaggcgggg
ctgcccgtggagcctgccaccttccagctgtacgtccccgccctgagcgctctctggagg
gactccggcatcagggaggcttttagccggaggagcgagttccagctgggtgaatccgtg
aagtactttctggacaacttggaccggatcggccagttgaattactttcccagcaagcag
gacatcctgctggcacggaaggccaccaagggcattgtggaacacgactttgtcatcaaa
aaaatcccttttaagatggtggacgtgggcggccagaggtcccagcgccagaagtggttc
cagtgcttcgacggcatcacgtccatcctgttcatggtgtcgtccagcgagtacgaccag
gtgctcatggaggacaggcgcaccaaccggctgctggaggccatgagcatcttcgagacc
atagtcaacaacaaactcttcttcaacgtctccataatccttttcctcaacaagacagac
ctcctggtggagaaggtcaagaccgtcagcatcaagaagcacttcccggacttcaagggc
gacccccacaggctggaggacgttcagcgctacctggtccagtgcttcgaccgcaagaga
cgcaaccgcaccaagcccctgtttcaccacttcaccaccgccatagacacggagaacatc
cgcttcgtgtttcacgctgtgaaggacaccatcctgcaggagaacctaaaggacatcatg
ctgcagtga

DBGET integrated database retrieval system