KEGG   Felis catus (domestic cat): 101087871Help
Entry
101087871         CDS       T02385                                 

Gene name
FADD
Definition
(RefSeq) FAS-associated death domain protein
  KO
K02373  FAS-associated death domain protein
Organism
fca  Felis catus (domestic cat)
Pathway
fca01524  Platinum drug resistance
fca04210  Apoptosis
fca04215  Apoptosis - multiple species
fca04217  Necroptosis
fca04620  Toll-like receptor signaling pathway
fca04621  NOD-like receptor signaling pathway
fca04622  RIG-I-like receptor signaling pathway
fca04657  IL-17 signaling pathway
fca04668  TNF signaling pathway
fca05010  Alzheimer disease
fca05142  Chagas disease (American trypanosomiasis)
fca05152  Tuberculosis
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05162  Measles
fca05163  Human cytomegalovirus infection
fca05164  Influenza A
fca05165  Human papillomavirus infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    101087871 (FADD)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101087871 (FADD)
   04215 Apoptosis - multiple species
    101087871 (FADD)
   04217 Necroptosis
    101087871 (FADD)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101087871 (FADD)
   04621 NOD-like receptor signaling pathway
    101087871 (FADD)
   04622 RIG-I-like receptor signaling pathway
    101087871 (FADD)
   04657 IL-17 signaling pathway
    101087871 (FADD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101087871 (FADD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101087871 (FADD)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101087871 (FADD)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101087871 (FADD)
   05162 Measles
    101087871 (FADD)
   05164 Influenza A
    101087871 (FADD)
   05161 Hepatitis B
    101087871 (FADD)
   05160 Hepatitis C
    101087871 (FADD)
   05168 Herpes simplex virus 1 infection
    101087871 (FADD)
   05163 Human cytomegalovirus infection
    101087871 (FADD)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101087871 (FADD)
   05169 Epstein-Barr virus infection
    101087871 (FADD)
   05165 Human papillomavirus infection
    101087871 (FADD)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    101087871 (FADD)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    101087871 (FADD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DED Death EcoEI_R_C Mor
Motif
Other DBs
NCBI-GeneID: 101087871
NCBI-ProteinID: XP_011285402
Position
D1
AA seq 215 aa AA seqDB search
MDPFLVLLHSVSAGLSSSELTELKFLCQSRVGKRKLERVQCGLDLFSVLLEQNELDRERT
GLLRELLASLRRQDLLGRLDSFEAGAAAEVSSEERDLRAAFDIICDHVGKDWRRLARQLR
VSDAMIDAIEEKYPRNLTEQVRESLRVWKNIHKEDPAVSHLVRALRACQMNLVADLIEDD
QQARSLESETSRGGSTGTVSLTSRDSDRPSSGVPW
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggacccgttcctggtgctgctgcactcggtgtcggccggcctgtcgagcagcgagctg
accgagctcaagttcttgtgccagagccgagtgggcaagaggaagctggagcgcgtgcag
tgcggcctcgacctcttctccgtgctgctcgagcagaacgagctggaccgcgagcgcacg
gggctgctgcgcgagctgctcgcctccctgcggcgccaggacctgctggggcgcctggac
agcttcgaggcgggcgcggcggccgaggtctcgtcggaggagcgagacctgcgtgcagcg
ttcgacatcatatgtgatcacgtggggaaggactggagaaggctggcccgccagcttcga
gtgtctgacgccatgatcgatgccatcgaggagaagtatccccgcaatctgacagagcag
gtgagggagtcgctgagagtctggaagaacatccacaaggaggacccggctgtgtcccac
ctggtgagggcgctcagggcctgccagatgaacctggtggccgacctcatcgaggacgat
cagcaggcccggagcctcgagagcgagaccagtcgaggtggcagcaccggcaccgtgtcc
ctgacgtcacgggactcagataggccgtcctcgggggtcccctggtga

DBGET integrated database retrieval system