KEGG   Felis catus (domestic cat): 101087958Help
Entry
101087958         CDS       T02385                                 

Gene name
MAPK3
Definition
(RefSeq) mitogen-activated protein kinase 3
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
fca  Felis catus (domestic cat)
Pathway
fca01521  EGFR tyrosine kinase inhibitor resistance
fca01522  Endocrine resistance
fca01524  Platinum drug resistance
fca04010  MAPK signaling pathway
fca04012  ErbB signaling pathway
fca04014  Ras signaling pathway
fca04015  Rap1 signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04024  cAMP signaling pathway
fca04062  Chemokine signaling pathway
fca04066  HIF-1 signaling pathway
fca04068  FoxO signaling pathway
fca04071  Sphingolipid signaling pathway
fca04072  Phospholipase D signaling pathway
fca04114  Oocyte meiosis
fca04140  Autophagy - animal
fca04150  mTOR signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04210  Apoptosis
fca04218  Cellular senescence
fca04261  Adrenergic signaling in cardiomyocytes
fca04270  Vascular smooth muscle contraction
fca04350  TGF-beta signaling pathway
fca04360  Axon guidance
fca04370  VEGF signaling pathway
fca04371  Apelin signaling pathway
fca04380  Osteoclast differentiation
fca04510  Focal adhesion
fca04520  Adherens junction
fca04540  Gap junction
fca04550  Signaling pathways regulating pluripotency of stem cells
fca04611  Platelet activation
fca04620  Toll-like receptor signaling pathway
fca04621  NOD-like receptor signaling pathway
fca04625  C-type lectin receptor signaling pathway
fca04650  Natural killer cell mediated cytotoxicity
fca04657  IL-17 signaling pathway
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04660  T cell receptor signaling pathway
fca04662  B cell receptor signaling pathway
fca04664  Fc epsilon RI signaling pathway
fca04666  Fc gamma R-mediated phagocytosis
fca04668  TNF signaling pathway
fca04713  Circadian entrainment
fca04720  Long-term potentiation
fca04722  Neurotrophin signaling pathway
fca04723  Retrograde endocannabinoid signaling
fca04724  Glutamatergic synapse
fca04725  Cholinergic synapse
fca04726  Serotonergic synapse
fca04730  Long-term depression
fca04810  Regulation of actin cytoskeleton
fca04910  Insulin signaling pathway
fca04912  GnRH signaling pathway
fca04914  Progesterone-mediated oocyte maturation
fca04915  Estrogen signaling pathway
fca04916  Melanogenesis
fca04917  Prolactin signaling pathway
fca04919  Thyroid hormone signaling pathway
fca04921  Oxytocin signaling pathway
fca04926  Relaxin signaling pathway
fca04928  Parathyroid hormone synthesis, secretion and action
fca04930  Type II diabetes mellitus
fca04933  AGE-RAGE signaling pathway in diabetic complications
fca04934  Cushing's syndrome
fca04960  Aldosterone-regulated sodium reabsorption
fca05010  Alzheimer's disease
fca05020  Prion diseases
fca05034  Alcoholism
fca05132  Salmonella infection
fca05133  Pertussis
fca05140  Leishmaniasis
fca05142  Chagas disease (American trypanosomiasis)
fca05145  Toxoplasmosis
fca05152  Tuberculosis
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05163  Human cytomegalovirus infection
fca05164  Influenza A
fca05165  Human papillomavirus infection
fca05167  Kaposi's sarcoma-associated herpesvirus infection
fca05200  Pathways in cancer
fca05203  Viral carcinogenesis
fca05205  Proteoglycans in cancer
fca05210  Colorectal cancer
fca05211  Renal cell carcinoma
fca05212  Pancreatic cancer
fca05213  Endometrial cancer
fca05214  Glioma
fca05215  Prostate cancer
fca05216  Thyroid cancer
fca05218  Melanoma
fca05219  Bladder cancer
fca05220  Chronic myeloid leukemia
fca05221  Acute myeloid leukemia
fca05223  Non-small cell lung cancer
fca05224  Breast cancer
fca05225  Hepatocellular carcinoma
fca05226  Gastric cancer
fca05230  Central carbon metabolism in cancer
fca05231  Choline metabolism in cancer
Module
fca_M00687  MAPK (ERK1/2) signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    101087958 (MAPK3)
   04015 Rap1 signaling pathway
    101087958 (MAPK3)
   04010 MAPK signaling pathway
    101087958 (MAPK3)
   04012 ErbB signaling pathway
    101087958 (MAPK3)
   04350 TGF-beta signaling pathway
    101087958 (MAPK3)
   04370 VEGF signaling pathway
    101087958 (MAPK3)
   04371 Apelin signaling pathway
    101087958 (MAPK3)
   04668 TNF signaling pathway
    101087958 (MAPK3)
   04066 HIF-1 signaling pathway
    101087958 (MAPK3)
   04068 FoxO signaling pathway
    101087958 (MAPK3)
   04072 Phospholipase D signaling pathway
    101087958 (MAPK3)
   04071 Sphingolipid signaling pathway
    101087958 (MAPK3)
   04024 cAMP signaling pathway
    101087958 (MAPK3)
   04022 cGMP - PKG signaling pathway
    101087958 (MAPK3)
   04151 PI3K-Akt signaling pathway
    101087958 (MAPK3)
   04150 mTOR signaling pathway
    101087958 (MAPK3)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    101087958 (MAPK3)
  Cell growth and death
   04114 Oocyte meiosis
    101087958 (MAPK3)
   04210 Apoptosis
    101087958 (MAPK3)
   04218 Cellular senescence
    101087958 (MAPK3)
  Cellular community - eukaryotes
   04510 Focal adhesion
    101087958 (MAPK3)
   04520 Adherens junction
    101087958 (MAPK3)
   04540 Gap junction
    101087958 (MAPK3)
   04550 Signaling pathways regulating pluripotency of stem cells
    101087958 (MAPK3)
  Cell motility
   04810 Regulation of actin cytoskeleton
    101087958 (MAPK3)
 Organismal Systems
  Immune system
   04611 Platelet activation
    101087958 (MAPK3)
   04620 Toll-like receptor signaling pathway
    101087958 (MAPK3)
   04621 NOD-like receptor signaling pathway
    101087958 (MAPK3)
   04625 C-type lectin receptor signaling pathway
    101087958 (MAPK3)
   04650 Natural killer cell mediated cytotoxicity
    101087958 (MAPK3)
   04660 T cell receptor signaling pathway
    101087958 (MAPK3)
   04658 Th1 and Th2 cell differentiation
    101087958 (MAPK3)
   04659 Th17 cell differentiation
    101087958 (MAPK3)
   04657 IL-17 signaling pathway
    101087958 (MAPK3)
   04662 B cell receptor signaling pathway
    101087958 (MAPK3)
   04664 Fc epsilon RI signaling pathway
    101087958 (MAPK3)
   04666 Fc gamma R-mediated phagocytosis
    101087958 (MAPK3)
   04062 Chemokine signaling pathway
    101087958 (MAPK3)
  Endocrine system
   04910 Insulin signaling pathway
    101087958 (MAPK3)
   04912 GnRH signaling pathway
    101087958 (MAPK3)
   04915 Estrogen signaling pathway
    101087958 (MAPK3)
   04914 Progesterone-mediated oocyte maturation
    101087958 (MAPK3)
   04917 Prolactin signaling pathway
    101087958 (MAPK3)
   04921 Oxytocin signaling pathway
    101087958 (MAPK3)
   04926 Relaxin signaling pathway
    101087958 (MAPK3)
   04919 Thyroid hormone signaling pathway
    101087958 (MAPK3)
   04928 Parathyroid hormone synthesis, secretion and action
    101087958 (MAPK3)
   04916 Melanogenesis
    101087958 (MAPK3)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101087958 (MAPK3)
   04270 Vascular smooth muscle contraction
    101087958 (MAPK3)
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101087958 (MAPK3)
  Nervous system
   04724 Glutamatergic synapse
    101087958 (MAPK3)
   04725 Cholinergic synapse
    101087958 (MAPK3)
   04726 Serotonergic synapse
    101087958 (MAPK3)
   04720 Long-term potentiation
    101087958 (MAPK3)
   04730 Long-term depression
    101087958 (MAPK3)
   04723 Retrograde endocannabinoid signaling
    101087958 (MAPK3)
   04722 Neurotrophin signaling pathway
    101087958 (MAPK3)
  Development
   04360 Axon guidance
    101087958 (MAPK3)
   04380 Osteoclast differentiation
    101087958 (MAPK3)
  Environmental adaptation
   04713 Circadian entrainment
    101087958 (MAPK3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    101087958 (MAPK3)
   05230 Central carbon metabolism in cancer
    101087958 (MAPK3)
   05231 Choline metabolism in cancer
    101087958 (MAPK3)
   05205 Proteoglycans in cancer
    101087958 (MAPK3)
   05203 Viral carcinogenesis
    101087958 (MAPK3)
   05210 Colorectal cancer
    101087958 (MAPK3)
   05212 Pancreatic cancer
    101087958 (MAPK3)
   05225 Hepatocellular carcinoma
    101087958 (MAPK3)
   05226 Gastric cancer
    101087958 (MAPK3)
   05214 Glioma
    101087958 (MAPK3)
   05216 Thyroid cancer
    101087958 (MAPK3)
   05221 Acute myeloid leukemia
    101087958 (MAPK3)
   05220 Chronic myeloid leukemia
    101087958 (MAPK3)
   05218 Melanoma
    101087958 (MAPK3)
   05211 Renal cell carcinoma
    101087958 (MAPK3)
   05219 Bladder cancer
    101087958 (MAPK3)
   05215 Prostate cancer
    101087958 (MAPK3)
   05213 Endometrial cancer
    101087958 (MAPK3)
   05224 Breast cancer
    101087958 (MAPK3)
   05223 Non-small cell lung cancer
    101087958 (MAPK3)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    101087958 (MAPK3)
   05020 Prion diseases
    101087958 (MAPK3)
  Substance dependence
   05034 Alcoholism
    101087958 (MAPK3)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    101087958 (MAPK3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101087958 (MAPK3)
   04934 Cushing's syndrome
    101087958 (MAPK3)
  Infectious diseases
   05132 Salmonella infection
    101087958 (MAPK3)
   05133 Pertussis
    101087958 (MAPK3)
   05152 Tuberculosis
    101087958 (MAPK3)
   05164 Influenza A
    101087958 (MAPK3)
   05161 Hepatitis B
    101087958 (MAPK3)
   05160 Hepatitis C
    101087958 (MAPK3)
   05163 Human cytomegalovirus infection
    101087958 (MAPK3)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    101087958 (MAPK3)
   05165 Human papillomavirus infection
    101087958 (MAPK3)
   05145 Toxoplasmosis
    101087958 (MAPK3)
   05140 Leishmaniasis
    101087958 (MAPK3)
   05142 Chagas disease (American trypanosomiasis)
    101087958 (MAPK3)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    101087958 (MAPK3)
   01524 Platinum drug resistance
    101087958 (MAPK3)
   01522 Endocrine resistance
    101087958 (MAPK3)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101087958 (MAPK3)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101087958 (MAPK3)
Chromosome and associated proteins [BR:fca03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     101087958 (MAPK3)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101087958 (MAPK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Haspin_kinase Kdo Choline_kinase FTA2
Motif
Other DBs
NCBI-GeneID: 101087958
NCBI-ProteinID: XP_023102893
Position
E3
AA seq 379 aa AA seqDB search
MAAAAAQGGGGGEPGGADGVGPGVSGEVEVVKGQPFDVGPRYTQLQYIGEGAYGMVSSAY
DHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRAPTLEAMRDVYI
VQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDL
KICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLS
NRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSD
AKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFDMELDDLPKERL
KELIFQETARFQPGALEAP
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggcggctcaggggggcgggggcggggagcccgggggagctgatggggtc
ggcccgggggtctcgggggaggtggaggtagtgaaggggcagccgttcgacgtgggcccg
cgctacacgcagctgcagtacatcggcgagggcgcgtacggcatggtcagctcagcttat
gaccacgtgcgcaagactcgcgtggccatcaagaaaatcagccccttcgagcatcagacc
tattgccagcgcacactgcgggagatccagatcttgctgcgcttccgccatgagaacgtc
attggcatccgggacattctgcgggcgcccaccctggaagccatgagggatgtctacatt
gtgcaggacctgatggagacagacctgtacaagttgctcaaaagccagcagctgagcaac
gaccacatttgctacttcctctaccagatcctgcggggcctcaagtatatccactcagcc
aacgtgctccaccgggatttaaagccctctaacctgctcatcaacaccacctgcgacctt
aagatctgtgattttggcctggcccggattgccgatcctgagcatgaccacactggcttc
ctgacagaatatgtggccacacgctggtaccgggctccagaaatcatgcttaactccaag
ggctacaccaagtccatcgacatctggtctgtgggctgcattctggctgagatgctctcc
aacaggcccatcttccctggcaagcactacctggaccagctcaaccacattctggggatc
ctgggctccccatcccaggaggacttgaattgtatcatcaacatgaaggcccgaaactac
ctacagtctctgccctccaagaccaaggtggcctgggccaagctttttcccaagtcagat
gccaaagcccttgatctgctagaccggatgttgacctttaaccccaacaaacggatcaca
gtggaggaagcactggctcacccctacctggagcagtactacgacccaacggatgagcca
gtggccgaggagcctttcaccttcgacatggagctggatgatctacccaaggaacggctg
aaggagctcatcttccaggagacagcccgcttccagcctggggcactggaggccccctaa

DBGET integrated database retrieval system