KEGG   Felis catus (domestic cat): 101087993Help
Entry
101087993         CDS       T02385                                 

Gene name
ITPR3
Definition
(RefSeq) LOW QUALITY PROTEIN: inositol 1,4,5-trisphosphate receptor type 3
  KO
K04960  inositol 1,4,5-triphosphate receptor type 3
Organism
fca  Felis catus (domestic cat)
Pathway
fca04020  Calcium signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04070  Phosphatidylinositol signaling system
fca04114  Oocyte meiosis
fca04210  Apoptosis
fca04218  Cellular senescence
fca04270  Vascular smooth muscle contraction
fca04371  Apelin signaling pathway
fca04540  Gap junction
fca04611  Platelet activation
fca04621  NOD-like receptor signaling pathway
fca04625  C-type lectin receptor signaling pathway
fca04713  Circadian entrainment
fca04720  Long-term potentiation
fca04723  Retrograde endocannabinoid signaling
fca04724  Glutamatergic synapse
fca04725  Cholinergic synapse
fca04726  Serotonergic synapse
fca04728  Dopaminergic synapse
fca04730  Long-term depression
fca04742  Taste transduction
fca04750  Inflammatory mediator regulation of TRP channels
fca04911  Insulin secretion
fca04912  GnRH signaling pathway
fca04915  Estrogen signaling pathway
fca04918  Thyroid hormone synthesis
fca04921  Oxytocin signaling pathway
fca04922  Glucagon signaling pathway
fca04924  Renin secretion
fca04925  Aldosterone synthesis and secretion
fca04927  Cortisol synthesis and secretion
fca04928  Parathyroid hormone synthesis, secretion and action
fca04934  Cushing syndrome
fca04970  Salivary secretion
fca04971  Gastric acid secretion
fca04972  Pancreatic secretion
fca05010  Alzheimer disease
fca05163  Human cytomegalovirus infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05170  Human immunodeficiency virus 1 infection
fca05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    101087993 (ITPR3)
   04020 Calcium signaling pathway
    101087993 (ITPR3)
   04070 Phosphatidylinositol signaling system
    101087993 (ITPR3)
   04022 cGMP-PKG signaling pathway
    101087993 (ITPR3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101087993 (ITPR3)
   04210 Apoptosis
    101087993 (ITPR3)
   04218 Cellular senescence
    101087993 (ITPR3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101087993 (ITPR3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101087993 (ITPR3)
   04621 NOD-like receptor signaling pathway
    101087993 (ITPR3)
   04625 C-type lectin receptor signaling pathway
    101087993 (ITPR3)
  09152 Endocrine system
   04911 Insulin secretion
    101087993 (ITPR3)
   04922 Glucagon signaling pathway
    101087993 (ITPR3)
   04912 GnRH signaling pathway
    101087993 (ITPR3)
   04915 Estrogen signaling pathway
    101087993 (ITPR3)
   04921 Oxytocin signaling pathway
    101087993 (ITPR3)
   04918 Thyroid hormone synthesis
    101087993 (ITPR3)
   04928 Parathyroid hormone synthesis, secretion and action
    101087993 (ITPR3)
   04924 Renin secretion
    101087993 (ITPR3)
   04925 Aldosterone synthesis and secretion
    101087993 (ITPR3)
   04927 Cortisol synthesis and secretion
    101087993 (ITPR3)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101087993 (ITPR3)
  09154 Digestive system
   04970 Salivary secretion
    101087993 (ITPR3)
   04971 Gastric acid secretion
    101087993 (ITPR3)
   04972 Pancreatic secretion
    101087993 (ITPR3)
  09156 Nervous system
   04724 Glutamatergic synapse
    101087993 (ITPR3)
   04725 Cholinergic synapse
    101087993 (ITPR3)
   04728 Dopaminergic synapse
    101087993 (ITPR3)
   04726 Serotonergic synapse
    101087993 (ITPR3)
   04720 Long-term potentiation
    101087993 (ITPR3)
   04730 Long-term depression
    101087993 (ITPR3)
   04723 Retrograde endocannabinoid signaling
    101087993 (ITPR3)
  09157 Sensory system
   04742 Taste transduction
    101087993 (ITPR3)
   04750 Inflammatory mediator regulation of TRP channels
    101087993 (ITPR3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101087993 (ITPR3)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101087993 (ITPR3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101087993 (ITPR3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101087993 (ITPR3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101087993 (ITPR3)
   05163 Human cytomegalovirus infection
    101087993 (ITPR3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101087993 (ITPR3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:fca01009]
    101087993 (ITPR3)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:fca04040]
    101087993 (ITPR3)
Protein phosphatases and associated proteins [BR:fca01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101087993 (ITPR3)
Ion channels [BR:fca04040]
 Ligand-gated channels
  IP3 receptor
   101087993 (ITPR3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ins145_P3_rec RYDR_ITPR MIR RIH_assoc Ion_trans
Motif
Other DBs
NCBI-GeneID: 101087993
NCBI-ProteinID: XP_023109625
Ensembl: ENSFCAG00000013659
Position
B2
AA seq 2671 aa AA seqDB search
MSEMSSFLHIGDIVSLYAEGSVNGFISTLGLVDDRCVVEPAAGDLDNPPKKFRDCLFKVC
PMNRYSAQKQYWKAKQTKQDKEKIADVVLLQKLQHAAQMEQKQNDTENKKVHGDVVKYGS
VIQLLHMKSNKYLTVNKRLPALLEKNAMRVTLDATGNEGSWLFIQPFWKLRSNGDNVVVG
DKVILNPVNAGQPLHASNYELSDNAGCKEVNSVNCNTSWKINLFMQFRDHLEEVLKGGDV
VRLFHAEQEKFLTCDEYKGKLQVFLRTTLRQSATSATSSNALWEVEVVHHDPCRGGAGHW
NGLYRFKHLATGNYLAAEENPSYKGDTCESKAAGMRAQGRAGRRNAGEKIKYRLVAVPHG
NDIASLFELDPTTLQKTDSFVPRNSYVRLRHLCTNTWIQSTNVPIDIEEERPIRLMLGTC
PTKEDKEAFAIVSVPVSEIRDLDFANDASSMLASAVEKLSEGFISQNDRRFVIQLLEDLV
FFVSDVPNNGQNVLDIMVTKPNRERQKLMREQNILKQIFGILKAPFRDKGGEGPLVRLEE
LSDQKNAPYQHMFRLCYRVLRHSQEDYRKNQEHIAKQFGMMQSQIGYDILAEDTITALLH
NNRKLLEKHITKTEVETFVSLVRKNREPRFLDYLSDLCVSNHIAIPVTQELICKCVLDPK
NSDILIQTELRPVKEMAQSHEYLSIEYSEEEVWLTWTDKNNEHHEKSVRQLAQEARAGNA
HDENVLSYYRYQLKLFARMCLDRQYLAIDEISQQLGVDLIFLCMADEMLPFDLRASFCHL
MLHVHVDRDPQELVTPVKFARLWTEIPTAITIKDYDSNLNASRDDKKNKFASTMDFVEDY
LNNVVSEAVPFANEEKNKLTFEVVSLAHNLIYFGFYSFSELLRLTRTLLGIIDCVQGPPA
MLQAYDDSGGKNVRRSIQGVGHMMSTMVLSRKQSVFGAPSLPAGSGATEPLDRSKFEDNE
DIVVMETKLKILEILQFILNVRLDYRISYLLSVFKKEFVEVFPMQDSGADGTAPAFDSTT
ANMNLDRIGEQAEAMFGVGKTSSMLEVDDEGGRMFLRVLIHLSMHDYAPLVSGALQLLFK
HFSQRQEAIHTFKQVQLLISAQDVENYKVIKSELDRLRTMVEKSELWVDKKGSSKGEEVE
AGATKDKKERPTDEEGFLHPPGEKSSENYQIVKGILERLNKMCGVGEQMRKKQQRLLKNM
DAHKVMLDLLQIPYDKGDAKMMEILRYTHQFLQKFCAGNPGNQALLHKHLHLFLTPGLLE
AETMQHIFLNNYQLCSEISEPVLQHFVHLLATHGRHVQYLDFLHTVIKAEGKYVKKCQDM
IMTELTNAGDDVVVFYNDKASLAHLLDMMKAARDGVEDHSPLMYHISLVDLLAACAEGKN
VYTEIKCTSLLPLEDVVSVVTHEDCITEVKMAYVNFVNHCYVDTEVEMKEIYTSNHIWTL
FENFTLDMARVCSKREKRLADPTLEKYVLTVVLDTINAFFSSPFSENSTSLQTHQTIVVQ
LLQSTTRLLECPWLQQQHKGSVEACIRTLAMVAKGRAISLPMDLDAHISSLLSSGTSCAA
AAQRNASNYKATTRAFPRVMPTANQWDYKNIIEKLQDIITALEERLRPLVQAELSVLVDV
LHWPELLFLEGSEAYQRCESGGFLSKLIQHTKDLMESEEKLCVKVLRTLQQMLLKKAKYG
DRGNQLRKMLLQNYLQNRKSSSRGDLPDPMSPGLDQDWSAIAATQCRLDKEGATKLVCDL
ITSTKNEKIFQESIGLAIRLLDGGNTEIQKSFYNLMTSDKKSERFFKVLHDRMKRAQQET
KSTVAVNMNDLGSQPREDRESADPTTKGRVASFSMPGSPSRYSLGPSLRRGHEVGERVQS
NEMGTSVLIMQPILRFLQLLCENHNRDLQNFLRSQNNKTNYNLVCETLQFLDIMCGSTTG
GLGLLGLYINEDNVGLVIQTLETLTEYCQGPCHENQTCIVTHESNGIDIITALILNDISP
LCKYRMDLVLQLKDNASKLLLALMESRHDSENAERILISLRPQELVDVIKKAYLQEEERE
NSEVSPREVGHNIYILALQLSRHNKQLQHLLKPVKRIQEEEAEGISSMLSLNNKQLSQML
KSSAPAQEEEEDPLAYYENHTSQIEIVRQDRSMEQIVFPVPGICQFLTEETKHRLFTTTE
QDEQGSKVSDFFDQSSFLHNEMEWQRKLRSMPLIYWFSRRMTLWGSISFNLAVFINIIIA
FFYPYMEGASTGVLGSPLISLLFWILICFSIAALFTKRYSIRPLIVALILRSIYYLGIGP
TLNILGALNLTNKIVFVVSFVGNRGTFIRGYKAMVMDMEFLYHVGYILTSVLGLFVHELF
YSILLFDLIYREETLFNVIKSVTRNGRSILLTALLALILVYLFSIVGFLFLKDDFILEVD
RLPGNHSGASPLGMPHGAATFVGTCSGDKLDCVSGVSVPEVLEGNEELESTERACDTLLM
CIVTVMNHGLRNGGGVGDILRKPSKDESLFPARVVYDLLFFFIVIIIVLNLIFGVIIDTF
ADLRSEKQKKEEILKTTCFICGLERDKFDNKTVSFEEHIKFEHNMWNYLYFIVLVRVKNK
TDYTGPESYVAQMIKNKNLDWFPRMRAMSLVSNEGEGEQNEIRILQDKLNSTMKLVSHLT
AQLNELKEQMTEQRKRRQRLGFVDVQNCMSR
NT seq 8016 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagatgtccagctttctccacatcggggacatcgtctccctgtacgccgagggc
tccgtcaatggcttcatcagcactttggggttggtggatgaccgctgtgtggtggagccc
gcggcaggggacctggacaacccccctaagaagttccgagactgcctcttcaaggtgtgt
cccatgaaccgctactcggcccagaagcagtactggaaggccaaacagacgaagcaggac
aaggagaagatcgctgacgtggtgctgctccaaaagttacagcacgcagcccagatggag
cagaagcagaatgacacggagaacaagaaggtgcacggggacgtcgtgaagtatggcagt
gtcatccagctcctgcacatgaagagcaacaagtacttgacagtgaacaagcggctgccg
gccctgctggagaagaatgccatgcgggtgacactggatgcaacaggcaacgagggctcc
tggctcttcatccagcccttctggaagcttcggagcaacggggacaatgtggtggtgggg
gacaaggtgatcctgaatcctgtcaacgccgggcagcctctgcatgccagcaattatgag
cttagcgacaatgctggctgcaaggaggtcaactctgtgaactgcaacaccagctggaag
atcaacctgttcatgcagttccgagaccacctggaggaggtgttgaaagggggagatgtg
gtgcggctgttccatgcggagcaggagaagttcctgacatgtgacgagtacaagggcaag
ctgcaggtgttcctgcgcaccacgctgcgccagtccgccacctcggccaccagctccaat
gccctctgggaagtggaggtggtccaccatgacccctgccgtggaggagccggtcactgg
aatggcctgtatcgcttcaagcacctggccacgggcaactacttggctgccgaggagaac
cccagttacaaaggcgatacctgtgagtccaaggcggcaggaatgcgtgctcagggtcgt
gcaggtcgccggaacgctggggagaagatcaagtaccgcttggtggctgtgccccatggc
aacgacattgcctccctctttgagctggaccccaccaccttgcagaaaactgactccttt
gtgcccaggaactcctatgtccggctgcggcacctctgcaccaacacgtggatccagagc
accaatgtacccatcgacattgaggaagagcggcccattcggctcatgctgggcacctgc
cccaccaaggaggacaaggaagcctttgccatcgtgtcagttccggtgtctgagatccgg
gacctggactttgccaacgatgccagctccatgctggccagtgccgtggagaaactcagc
gagggtttcatcagccagaatgaccgcaggtttgtcatccagctgctggaggacctggtg
ttcttcgtcagcgatgtgcccaacaatgggcagaatgtgctggacatcatggtcaccaag
cccaaccgggaacggcagaagctgatgcgcgagcagaacatcctcaaacagatctttggc
attctgaaggcccctttccgtgacaaggggggtgagggccccctggtgcggctggaggag
ctgtcagaccagaagaatgccccctaccagcacatgttccgcctctgctaccgggtgctg
cggcattcccaggaggattaccgtaagaaccaggagcacatcgccaagcagttcgggatg
atgcagtcccagatcggctatgacatcctggcagaagacaccatcactgccctcctgcac
aacaaccgcaagctcctggagaagcacatcaccaagaccgaggtggagaccttcgtcagc
ctcgtacggaagaacagggagcccaggttcctggactacctctctgacctgtgtgtgtcc
aaccacatcgccatccctgtcacccaagagctcatctgcaaatgtgtgctggaccccaag
aacagtgacattctcatccagactgagctgcggccggtgaaggagatggcccagtcccac
gagtacctgagcatcgagtactcagaggaggaggtgtggctcacttggaccgacaagaat
aacgagcaccacgagaagagcgtgaggcagctggcccaggaggcgcgggccggcaatgcc
cacgacgagaacgtgctcagctactacaggtaccagctgaagctctttgcccgcatgtgc
ctggaccgccagtacctggccatcgacgagatctcccagcagctgggtgttgacctgatc
ttcctgtgtatggcagacgaaatgctgccctttgacctacgcgcctccttctgccacctg
atgctgcacgtgcacgtggacagggacccccaggagctggtcacgcctgtcaagttcgcc
cgcctctggactgagatccccacagccatcaccatcaaggactatgattccaacctaaac
gcctctcgagatgacaagaagaacaagtttgccagcactatggacttcgtggaggactac
ctcaacaatgtggtcagcgaggccgtgccctttgccaatgaggagaagaacaagctcacc
tttgaggtggtcagcctggcgcacaatctcatctacttcggcttctacagcttcagtgag
ctgctgcggctcactcgcactctgttgggcatcatcgactgcgtgcaggggcccccggcc
atgctacaggcctacgatgactcaggcggcaagaacgtgcggcggtccatccagggtgtg
ggccacatgatgtccaccatggtgctaagccgaaagcagtctgtctttggcgcccccagc
ctgcctgctggctctggtgccactgagccactggaccgaagcaagtttgaggacaatgaa
gacattgtggtgatggagactaagctgaagatcctggaaatcttgcagttcatcctcaat
gtccgcctggattaccgcatctcctacctgctgtccgtcttcaagaaggagtttgtggag
gtgtttcccatgcaggacagcggggccgatggcacagccccggccttcgactccacaact
gccaacatgaacctggatcgcatcggggagcaggcggaggccatgtttggagtagggaag
acaagcagcatgctggaggtggacgacgagggcggccgcatgttcctacgggtgcttatc
cacctcagcatgcacgactacgcgccgctggtctcgggggcccttcagttgctcttcaag
catttcagccagcgccaggaggccattcacaccttcaagcaggtgcagctgctgatctca
gctcaggatgtggagaactacaaggtgatcaagtcagagctggaccggctgcggaccatg
gtcgagaagtcggagctgtgggtcgacaagaagggcagcagcaagggcgaggaggtggag
gcaggtgctaccaaagacaagaaggagcggcccacagacgaggagggctttctgcaccca
cctggggagaagagcagtgagaactaccagatcgtcaagggcatcctggagcggctgaac
aagatgtgcggtgttggggagcagatgaggaagaagcagcagaggctgctcaagaacatg
gacgcccacaaggtcatgctggacctgctgcagatcccctatgacaagggtgatgccaag
atgatggagatcctgcggtacacgcaccagttcctgcagaagttctgcgcggggaacccc
ggcaaccaggccctgctgcataagcacctgcacctcttcctcacaccagggctcctggag
gcagagaccatgcagcacatcttcctgaacaactaccagctgtgctctgaaatcagcgag
cccgtgttgcagcacttcgtgcacctgctggccacgcacgggcggcacgttcagtatctg
gacttcctgcacaccgtcatcaaggccgagggcaagtacgtcaagaagtgccaggacatg
atcatgacggagctgaccaatgcaggtgacgacgtggtcgtgttctacaatgacaaggcc
tcactggcccacctgctggacatgatgaaggctgcccgggatggtgtggaggaccacagc
cccctcatgtatcacatctccctggtggacctgctggctgcctgtgccgagggcaagaac
gtctacactgagatcaagtgcacctccctgctgcccctggaagacgtggtgtctgtggtg
acacacgaggactgcatcaccgaggtgaaaatggcctacgtgaacttcgtgaatcactgc
tacgtggacacagaggtggagatgaaggagatctacaccagcaaccacatctggacactc
tttgagaacttcaccctggacatggctcgggtctgcagtaagcgtgagaagcgcctggct
gaccccaccctggagaagtatgtgctgactgtcgtgctggacaccatcaacgccttcttc
agctctccgttctcggagaacagcacctccctgcagacacaccagacaatcgtggtgcag
ctgctgcagtccaccacacggctgctcgagtgtccgtggctgcagcagcagcacaagggc
tccgtggaggcctgtatccggaccctcgccatggtggccaaaggccgggccatctcactg
cccatggacctggatgcacacatcagctcgctgctcagcagcggcaccagctgtgcagct
gcagcccagcgcaacgcctccaactacaaggcgaccacgcgggccttcccccgtgtcatg
cccaccgccaaccagtgggactacaagaacatcatcgagaagctgcaggacatcatcacg
gccctggaggagcggctgaggcccctggtacaggccgaactgtccgtgctggtggacgtc
ctgcactggcccgagctgctcttcctggagggcagtgaggcctaccagcgctgtgagagt
gggggcttcctgtccaagctgatccagcacaccaaggacctcatggagtcggaggagaag
ctgtgtgtcaaggtgctgcggaccctgcagcaaatgctgctcaagaaggccaagtacggg
gaccggggcaatcagctgcgcaagatgctgctacaaaactacctccagaaccggaagtcc
agctcgaggggggaccttccggaccccatgagccctggcctggaccaagactggtcagca
attgcggccacccagtgccggctggacaaggagggggccaccaagctggtatgtgacctg
atcaccagcaccaagaatgagaagattttccaggagagcattggcctggccatccgcctg
ctggatggtggcaacacggagatccagaaatccttctacaacctgatgacgagtgacaag
aagtcagagcgcttcttcaaggtgctgcatgaccgcatgaagcgggcccagcaggagacc
aagtccacggtggccgtcaacatgaatgacctgggcagccagccgcgcgaggaccgggag
tcggcagaccccaccaccaaaggccgcgtggcctccttctcgatgccaggctccccatcc
cgctattcgctgggccccagcctgcgccgggggcacgaggtgggcgagcgcgtgcagagc
aacgagatgggcacgtccgtgctcatcatgcagcccatcctgcgctttctgcagctgctg
tgtgagaaccacaaccgagacctgcagaacttcctgcgctcccagaacaacaagaccaac
tacaacctggtgtgtgagacactgcagttcctggacatcatgtgcggcagcaccaccggt
ggcctggggctgctggggctttacatcaatgaggacaacgtgggccttgtcatccagacc
ctggagaccctcactgagtactgtcagggcccctgccacgagaaccagacctgcatcgtg
acgcatgagtccaacggcatagacatcatcacagccctgattcttaatgacatcagtccc
ctgtgcaaataccgtatggatctggtgctgcagcttaaggacaatgcctccaagctgctc
ctggctctgatggagagccggcacgacagtgaaaacgctgagcgaatcctcatcagcctg
cggccccaggagctggtggacgtcatcaagaaagcctacctgcaggaggaggagcgggaa
aactcggaggtgagcccacgggaagtgggccacaacatctacatcctggcgctgcagctc
tccaggcacaacaagcagctgcagcacctgctcaagccagtgaagcgcatccaagaggag
gaggccgagggcatctcttctatgctcagcctcaacaacaagcagctgtcccagatgctc
aagtcctccgcgcccgcacaagaggaggaggaggaccccctggcctactacgagaaccac
acatcccagatagagatcgtgcgacaggaccgcagcatggagcagatcgtgttcccggtg
cctggcatctgccagttcctgacggaggagaccaagcaccggctcttcaccaccacggag
caggatgagcagggcagcaaagtgagcgacttcttcgaccagtcctccttcctgcacaac
gaaatggagtggcagcgcaagctccgcagcatgccactgatctactggttctcccgccga
atgaccctgtggggcagtatttccttcaacctggcagtttttatcaacatcatcattgcc
ttcttctacccctacatggagggcgcgtccacaggcgtgctgggctccccactcatctca
ctgctgttctggatcctcatctgtttctccatcgcggccttgttcaccaagcgctacagc
atccgccccctcattgtggcgctcatcctgcgctccatctactacctgggcattgggccc
acactcaacatcctgggcgccctcaacctgaccaacaagattgtatttgtggtgagcttt
gtgggcaaccgcggaaccttcatccggggctataaggccatggtcatggacatggagttc
ctctaccatgtgggctacatcctgacgagtgtcctgggcctctttgtccacgagctcttc
tacagcatcctgctctttgacctcatctaccgggaggagacgctgttcaacgtcatcaag
agtgtgactcgaaatggccgttccatcctgctgaccgccctgctggccctcatcctggtc
tacctcttctccatcgttggcttcctcttcctcaaggatgacttcatccttgaggttgac
cggctgcccggcaatcactctggagccagccccctggggatgccacatggagctgccaca
tttgtgggcacgtgcagtggggacaagctggactgtgtctcaggggtctcagtgcctgag
gtcctggaagggaacgaagagctggagagcacggagcgggcctgcgacacgctgctcatg
tgcatcgtcactgtcatgaaccacgggctgcgcaatggtggtggcgtgggcgacattctc
cgcaagccctccaaagacgagtccctcttcccggcccgtgtggtctacgacctcctgttc
ttcttcattgtcatcatcatcgtgctgaacctcatctttggggtgatcattgacaccttt
gctgacctgcgcagcgagaagcagaagaaggaggagattcttaagaccacgtgcttcatc
tgcggtctggagagagacaagtttgataacaagacggtgtcctttgaggaacacatcaag
ttcgagcacaacatgtggaactacctgtacttcatcgtgctggtccgcgtcaaaaacaag
acggactacacggggcctgagagctacgtggcccagatgatcaagaacaagaacctggac
tggttcccccggatgagggccatgtccctagtgagcaacgagggggaaggggagcagaat
gagatccggattcttcaggataagctcaactccaccatgaagctggtgtcccacctcacc
gcccagctcaacgagctcaaggagcagatgacagagcagcggaaacgcaggcaacgcctg
ggctttgtggacgtccagaactgcatgagccgctga

KEGG   Felis catus (domestic cat): 101100546Help
Entry
101100546         CDS       T02385                                 

Gene name
ITPR1
Definition
(RefSeq) inositol 1,4,5-trisphosphate receptor type 1 isoform X3
  KO
K04958  inositol 1,4,5-triphosphate receptor type 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04020  Calcium signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04070  Phosphatidylinositol signaling system
fca04114  Oocyte meiosis
fca04140  Autophagy - animal
fca04210  Apoptosis
fca04218  Cellular senescence
fca04270  Vascular smooth muscle contraction
fca04371  Apelin signaling pathway
fca04540  Gap junction
fca04611  Platelet activation
fca04621  NOD-like receptor signaling pathway
fca04625  C-type lectin receptor signaling pathway
fca04713  Circadian entrainment
fca04720  Long-term potentiation
fca04723  Retrograde endocannabinoid signaling
fca04724  Glutamatergic synapse
fca04725  Cholinergic synapse
fca04726  Serotonergic synapse
fca04728  Dopaminergic synapse
fca04730  Long-term depression
fca04750  Inflammatory mediator regulation of TRP channels
fca04912  GnRH signaling pathway
fca04915  Estrogen signaling pathway
fca04918  Thyroid hormone synthesis
fca04921  Oxytocin signaling pathway
fca04922  Glucagon signaling pathway
fca04924  Renin secretion
fca04925  Aldosterone synthesis and secretion
fca04927  Cortisol synthesis and secretion
fca04928  Parathyroid hormone synthesis, secretion and action
fca04934  Cushing syndrome
fca04970  Salivary secretion
fca04971  Gastric acid secretion
fca04972  Pancreatic secretion
fca05010  Alzheimer disease
fca05016  Huntington disease
fca05163  Human cytomegalovirus infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05170  Human immunodeficiency virus 1 infection
fca05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    101100546 (ITPR1)
   04020 Calcium signaling pathway
    101100546 (ITPR1)
   04070 Phosphatidylinositol signaling system
    101100546 (ITPR1)
   04022 cGMP-PKG signaling pathway
    101100546 (ITPR1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101100546 (ITPR1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    101100546 (ITPR1)
   04210 Apoptosis
    101100546 (ITPR1)
   04218 Cellular senescence
    101100546 (ITPR1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101100546 (ITPR1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101100546 (ITPR1)
   04621 NOD-like receptor signaling pathway
    101100546 (ITPR1)
   04625 C-type lectin receptor signaling pathway
    101100546 (ITPR1)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    101100546 (ITPR1)
   04912 GnRH signaling pathway
    101100546 (ITPR1)
   04915 Estrogen signaling pathway
    101100546 (ITPR1)
   04921 Oxytocin signaling pathway
    101100546 (ITPR1)
   04918 Thyroid hormone synthesis
    101100546 (ITPR1)
   04928 Parathyroid hormone synthesis, secretion and action
    101100546 (ITPR1)
   04924 Renin secretion
    101100546 (ITPR1)
   04925 Aldosterone synthesis and secretion
    101100546 (ITPR1)
   04927 Cortisol synthesis and secretion
    101100546 (ITPR1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101100546 (ITPR1)
  09154 Digestive system
   04970 Salivary secretion
    101100546 (ITPR1)
   04971 Gastric acid secretion
    101100546 (ITPR1)
   04972 Pancreatic secretion
    101100546 (ITPR1)
  09156 Nervous system
   04724 Glutamatergic synapse
    101100546 (ITPR1)
   04725 Cholinergic synapse
    101100546 (ITPR1)
   04728 Dopaminergic synapse
    101100546 (ITPR1)
   04726 Serotonergic synapse
    101100546 (ITPR1)
   04720 Long-term potentiation
    101100546 (ITPR1)
   04730 Long-term depression
    101100546 (ITPR1)
   04723 Retrograde endocannabinoid signaling
    101100546 (ITPR1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101100546 (ITPR1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101100546 (ITPR1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101100546 (ITPR1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101100546 (ITPR1)
   05016 Huntington disease
    101100546 (ITPR1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101100546 (ITPR1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101100546 (ITPR1)
   05163 Human cytomegalovirus infection
    101100546 (ITPR1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101100546 (ITPR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:fca01009]
    101100546 (ITPR1)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:fca04040]
    101100546 (ITPR1)
Protein phosphatases and associated proteins [BR:fca01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101100546 (ITPR1)
Ion channels [BR:fca04040]
 Ligand-gated channels
  IP3 receptor
   101100546 (ITPR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ins145_P3_rec RYDR_ITPR MIR RIH_assoc Ion_trans
Motif
Other DBs
NCBI-GeneID: 101100546
NCBI-ProteinID: XP_011278472
Ensembl: ENSFCAG00000002477
Position
A2
AA seq 2748 aa AA seqDB search
MSDKMSSFLHIGDICSLYAEGSTNGFISTLGLVDDRCVVQPEAGDLNNPPKKFRDCLFKL
CPMNRYSAQKQFWKAAKPGANSTTDAVLLNKLHHAADLEKKQNETENRKLLGTVIQYGNV
IQLLHLKSNKYLTVNKRLPALLEKNAMRVTLDEAGNEGSWFYIQPFYKLRSIGDSVVIGD
KVVLNPVNAGQPLHASSHQLVDNPGCNEVNSVNCNTSWKIVLFMKWSDNKDDILKGGDVV
RLFHAEQEKFLTCDEHRKKQHVFLRTTGRQSATSATSSKALWEVEVVQHDPCRGGAGYWN
SLFRFKHLATGHYLAAEVDPDFEEECLEFQPSVDPDQDASRSRLRNAQEKMVYSLVSVPE
GNDISSIFELDPTTLRGGDSLVPRNSYVRLRHLCTNTWVHSTNIPIDKEEEKPVMLKIGT
SPVKEDKEAFAIVPVSPAEVRDLDFANDASKVLGSIAGKLEKGTITQNERRSVTKLLEDL
VYFVTGGTNSGQDVLEVVFSKPNRERQKLMREQNILKQIFKLLQAPFTDCGDGPMLRLEE
LGDQRHAPFRHICRLCYRVLRHSQQDYRKNQEYIAKQFGFMQKQIGYDVLAEDTITALLH
NNRKLLEKHITAAEIDTFVSLVRKNREPRFLDYLSDLCVSMNKSIPVTQELICKAVLNPT
NADILIETKLVLSRFEFEGVSTGENALEAGEDEEEVWLFWRDSNKEIRSKSVRELAQDAK
EGQKEDRDVLSYYRYQLNLFARMCLDRQYLAINEISGQLDVDLILRCMSDENLPYDLRAS
FCRLMLHMHVDRDPQEQVTPVKYARLWSEIPSEIAIDDYDSSGASKDEIKERFAQTMEFV
EEYLRDVVCQRFPFSDKEKNKLTFEVVNLARNLIYFGFYNFSDLLRLTKILLAILDCVHV
TTIFPISKMAKGEENKGSNVMRSIHGVGELMTQVVLRGGGFLPMTPMAAAPEGNVKQTEP
EKEDIMVMDTKLKIIEILQFILNVRLDYRISCLLCIFKREFDESNSQTSETSSGGSSQEG
PSNVPGTLDFEHIEEQAEGIFGGSEENTPLDLDDHGGRTFLRVLLHLTMHDYPPLVSGAL
QLLFRHFSQRQEVLQAFKQVQLLVTSQDVDNYKQIKQDLDQLRSIVEKSELWVYKGQGPD
EAMDGVSGEIEHKKTEEGNNKSQKHESTSSYNYRVVKEILIRLSKLCVQESATVRKSKKQ
QQRLLRNMGAHAVVLELLQIPYEKAEDTKMQEIMRLAHEFLQNFCAGNQQNQALLHKHIN
LFLNPGILEAVTMQHIFMNNFQLCSEINERVVQHFVHCIETHGRNVQYIKFLQTIVKAEG
KFIKKCQDMVMAELVNSGEDVLVFYNDRASFQTLIQMMRSERDRMDENSPLMYHIHLVEL
LAVCTEGKNVYTEIKCNSLLPLDDIVRVVTHEDCIPEVKIAYINFLNHCYVDTEVEMKEI
YTSNHMWKLFENFLVDICRACNNTSDRKHADSILEKYVTEIVMSIVTTFFSSPFSDQSTT
LQTRQPVFVQLLQGVFRVYHCNWLMPSQKASVESCIRVLSDVAKSRAIAIPVDLDSQVNN
LFLKSHNIVQKTAMNWRLTARNAARRDSVLAASRDYRNIIERLQDIVSALEDRLRPLVQA
ELSVLVDVLHRPELLFPENTDARRKCESGGFICKLIKHTKQLLEENEEKLCIKVLQTLRE
MMTKDRGYGEKLISIDELDNAELPQAPDSENSTEELEPSPPLRQLEDHKRGEALRQILVN
RYYGNIRPSGRRESLTSFGNGPLSPGGPSKPGGGAGGSGSSSTSRGEMSLAEVQCHLDKE
GASNLVIDLIMNASSDRVFHESILLAIALLEGGNTTIQHSFFCRLTEDKKSEKFFKVFYD
RMKVAQQEIKATVTVNTSDLGNKKKDDEIDRDAPSRKKAKEPSTQITEEVRDQLLEASAA
TRKAFTTFRREADPDDHYPSGEGAQATADKTKDDLEMSAVITIMQPILRFLQLLCENHNR
DLQNFLRCQNNKTNYNLVCETLQFLDCICGSTTGGLGLLGLYINEKNVALINQTLESLTE
YCQGPCHENQNCIATHESNGIDIITALILNDINPLGKKRMDLVLELKNNASKLLLAIMES
RHDSENAERILYNMRPKELVEVIKKAYMQGEVEFEDGENGEDGAASPRNVGHNIYILAHQ
LARHNKELQTMLKPGGQVDGDEALEFYAKHTAQIEIVRLDRTMEQIVFPVPSICEFLTKE
SKLRIYYTTERDEQGSKINDFFLRSEDLFNEMNWQKKLRAQPVLYWCARNMSFWSSISFN
LAVLMNLLVAFFYPFKGVRGGTLEPHWSGLLWTAMLISLAIVIALPKPHGIRALIASTIL
RLIFSVGLQPTLFLLGAFNVCNKIIFLMSFVGNCGTFTRGYRAMVLDVEFLYHLLYLLIC
AMGLFVHEFFYSLLLFDLVYREETLLNVIKSVTRNGRSIILTAVLALILVYLFSIVGYLF
FKDDFILEVDRLPNETALPEAGESLASEFLYSDVCRVETGENCSSPAPKEELVLTEETEQ
DKEHTCETLLMCIVTVLSHGLRSGGGVGDVLRKPSKEEPLFAARVIYDLLFFFMVIIIVL
NLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVTFEEHIKEEHNMWHYL
CFIVLVKVKDSTEYTGPESYVAEMIKERNLDWFPRMRAMSLVSSDSEGEQNELRNLQEKL
ESTMKLVTNLSGQLSELKDQMTEQRKQKQRIGLLGHPPHMNVNPQQPA
NT seq 8247 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacaagatgtctagtttcctacatattggagacatttgttctctgtacgcggaa
ggatcgacaaatggatttattagcaccttgggcctggttgacgatcgttgtgttgtacag
ccagaagctggggaccttaataatccacccaagaaattcagagattgcctctttaagcta
tgtcccatgaatcgctactctgcccagaagcagttctggaaagctgccaagccaggggcc
aacagtacaaccgatgcagtgctgctcaacaaactgcaccatgctgcagacttggaaaag
aagcagaatgagacagaaaacaggaaattgcttgggactgtaatccagtatggcaacgtg
atccagctcctgcatttgaaaagtaataaatacctaactgtgaataagaggcttccagcg
ctcctggagaagaatgccatgagagtgactttggacgaagctggaaatgaagggtcctgg
ttttatattcagccattctacaaactgcgatccatcggagacagtgtggtcataggtgac
aaggttgtactgaaccccgtcaatgctggccagcccctacatgccagcagccatcagctg
gtggataacccaggctgcaatgaggtaaattctgtcaactgcaatactagctggaaaatt
gtccttttcatgaaatggagcgataacaaagacgacatactgaaggggggtgacgtggta
aggctgttccatgcggagcaggagaagttcctcacctgtgatgagcacaggaagaagcag
catgtgttcttgagaactaccggccggcagtcagctacatctgccacgagttcgaaggcc
ctgtgggaggtggaggtagtccaacatgacccatgtcggggtggagccggatactggaat
agcctcttccgtttcaagcatcttgctactgggcattacttagcagcagaggtagaccct
gactttgaggaagaatgcctggagtttcagccctcagtggatcctgatcaggatgcttct
cgaagcaggttgcgaaatgcccaagaaaagatggtgtactccctggtctctgtgcctgag
ggcaatgacatctcctccatttttgagctggaccccaccactctccgtggaggtgatagc
cttgtcccaagaaactcctatgtccgactcagacacctttgcactaatacctgggttcat
agcacaaatatcccaatcgacaaggaagaagaaaaacctgtaatgctgaaaattggcacc
tcccctgtgaaggaggataaggaagcatttgccatagttccggtttctcctgctgaggtt
cgggacctggattttgccaatgatgccagcaaggtgctgggctctatagctgggaagctg
gagaaaggcaccatcactcagaatgaaagaaggtctgtaaccaagctgctggaagacttg
gtttactttgtcactggtggcactaactctggtcaagatgtgcttgaagtggtcttctcc
aagcctaacagagaacggcagaagctgatgagagaacagaatatcctcaagcagatcttc
aaattgttacaagccccgttcacagactgtggcgatggcccaatgctgcggctcgaggag
cttggggaccagcggcatgctcctttcagacatatctgtcggctctgctacagggtcctg
agacactctcagcaagactacaggaaaaaccaggagtacatagccaaacagtttggcttt
atgcagaagcaaattggctatgatgtgttggccgaagacaccatcaccgccctgcttcac
aataaccgaaaactcctggaaaaacacatcactgccgctgagatcgacacgtttgtcagt
ctggtgcgaaagaacagggagcccagattcttagattacctctccgacctctgtgtttcc
atgaacaaatcgatcccggtgacccaggaactgatatgtaaagctgtgctgaatccaacc
aatgctgacatcctgattgagaccaagctggttctttctcgttttgaatttgagggtgtt
tctactggagagaatgctctggaagcaggagaagacgaggaagaggtgtggctcttttgg
agggacagcaacaaggagattcgcagcaaaagtgtccgggaactggcccaagatgccaaa
gaagggcagaaggaggaccgcgatgttctcagctactacaggtatcagttgaaccttttt
gctaggatgtgtctagaccgccaatacctggccatcaatgaaatatcaggccagctggat
gtagatctcattctccgctgcatgtctgatgagaacctgccctatgacctgagggcatcc
ttctgtcgcctcatgcttcatatgcacgtggaccgagatccccaggaacaagtcactccc
gtgaaatatgcccgcctctggtctgagattccctcggagatcgccattgatgactatgat
agtagtggagcttccaaagatgaaattaaggagaggtttgctcagaccatggaatttgtg
gaggagtatttaagagatgtggtttgtcagaggtttcctttctctgataaggagaaaaat
aagcttacatttgaggttgtaaatttagctaggaatctcatctactttggtttctacaac
ttctctgaccttctacgattgaccaaaattctcttggccatactggactgtgtgcatgtg
acgaccatctttcccattagtaagatggcgaaaggagaagagaataaaggaagtaatgta
atgcggtccatccatggggttggagagctgatgacccaggtggtgctccgcggaggaggc
tttttacccatgactcctatggctgctgcccctgaaggcaacgtgaagcagacagagcca
gagaaggaggatatcatggtcatggacaccaagttgaagatcattgaaatactccagttt
attttgaatgtgaggttggattataggatctcctgcctcctgtgtatatttaagcgagaa
tttgatgaaagcaattcccagacttcggaaacatcctccggaggcagcagccaagagggg
ccaagtaacgtaccaggtactcttgactttgaacatattgaagagcaagcagaaggcatc
tttggaggaagtgaggagaacacaccgctggacttggacgaccatggtggcagaaccttc
ctccgagtcttgctgcatttgacaatgcacgactacccacccctggtgtcaggggccctg
cagctcctctttcggcacttcagtcagaggcaggaggtcctgcaggccttcaaacaggtt
cagctgcttgttaccagccaagatgtggacaactacaaacagatcaaacaagacttggac
cagctgagatccattgtggaaaaatcggagctttgggtgtacaaagggcagggccctgat
gaggccatggatggtgtctctggtgaaatcgaacataagaaaacagaggaggggaataac
aagtcacagaagcatgagagcaccagcagctacaattacagggtggtcaaagagatcctg
attcggctcagcaaactctgcgtgcaggagagcgccaccgtgaggaagagcaagaagcag
cagcagcgcctgctccggaacatgggcgcgcacgcagtggtgctcgagctgctgcagatc
ccctacgagaaggctgaagataccaagatgcaggagataatgaggctggctcatgaattt
ctgcagaatttctgtgctggcaaccagcagaatcaagcattgctacacaaacacataaac
ctgtttctcaacccagggatcctggaggcggtaaccatgcagcacatcttcatgaacaac
ttccagctctgcagtgagatcaatgaaagggtcgtccagcactttgttcactgcatcgag
actcacggtcggaacgtccagtacatcaagttcttgcagacgattgtcaaggcggaaggg
aaattcattaaaaagtgccaagacatggttatggctgagctggttaattcgggagaggac
gtcctcgtgttctacaatgacagagcctctttccagaccctaatccagatgatgaggtca
gagcgggaccggatggatgagaacagccctctcatgtaccacatccacctggttgagctc
ttggccgtatgcactgagggcaagaacgtctatacagagataaagtgcaactctctgctc
ccactggatgacattgtccgtgtagtgacccatgaggattgcatccccgaggttaaaatt
gcctacattaacttccttaatcactgctacgtggatactgaggtggaaatgaaggagatt
tataccagcaatcacatgtggaagttgtttgagaatttccttgtagacatctgcagggcc
tgtaacaacacaagtgacaggaagcatgcagactcaattttggaaaagtacgttactgaa
atcgtcatgagtatcgttactaccttcttcagttctcccttctcagaccagagtactacc
ctgcagactcgccagcctgtctttgtgcaactgctacaaggtgtgttcagggtttaccac
tgcaactggttaatgccgagccaaaaagcctctgtggagagctgtattcgggtgctctct
gatgtagccaagagccgggccatcgctattcctgtggacctggacagccaagtcaacaac
ctcttcctgaagtctcacaacattgtgcagaaaactgccatgaactggcgactgaccgcc
cgcaatgcggctcgcagagactctgttctggcggcttccagagactaccggaatatcatt
gagagattgcaggacattgtctcagccctggaggaccgtctgaggcccctagtccaggca
gagttatctgtgctcgtggatgtgctccaccgacctgagctacttttcccagagaacaca
gatgccagaagaaagtgcgaaagcggtggcttcatttgcaagttaataaagcatactaaa
cagctgctagaggagaatgaagagaaactctgcattaaggtcctgcagactctcagagaa
atgatgaccaaagatagaggctatggagaaaagctaatttccattgatgaattggataat
gctgagctaccacaagctccggattctgagaactccacagaggaacttgaaccgagtccc
cccctgaggcaactggaagaccataaaaggggtgaggcgctcaggcaaattttggtcaac
cgttactatggaaacatcagaccttcaggaagaagagaaagcctcaccagctttggcaat
ggcccgctgtcaccaggaggacccagcaagcctgggggaggagcgggaggctctgggtcc
agctccacaagcaggggtgagatgagcctggctgaggttcagtgccacctcgacaaggag
ggtgcctctaatctggtcattgacctcataatgaacgcgtccagtgaccgagtgtttcat
gaaagcattctcctggccattgcccttctggaaggaggcaacaccactatacagcactcc
tttttctgccggttaacagaagataagaagtcggaaaaattcttcaaggtcttctatgac
cgaatgaaggtggcccagcaggaaatcaaggcaacagtgactgtgaacaccagtgacttg
gggaataaaaagaaagatgatgagatagacagggatgccccatcacggaaaaaagccaaa
gagccctcaacacaaataacagaagaggtccgagatcagctcctggaggcctctgctgcc
acaaggaaagccttcaccaccttcaggagggaggctgaccccgatgatcactacccgtct
ggggaaggtgcccaggctacggcggacaagaccaaggatgacctggagatgagtgcggtc
atcaccatcatgcagcccattctccggttcctgcagctcctgtgtgaaaaccacaaccga
gacctgcagaacttccttcgttgtcaaaataacaagaccaactacaatttggtgtgtgag
acactacagttcctggactgtatttgcggaagcactactggaggtcttggtcttcttggg
ctctatataaacgaaaagaacgtagcccttatcaaccaaaccctggaaagtctgactgaa
tactgtcaaggaccgtgccatgagaaccagaactgcatagctacccatgaatccaatggc
attgacatcatcacagccctgatccttaatgacatcaatcctttgggaaagaagaggatg
gaccttgtattggaactgaagaacaatgcttccaagttgctgctggccatcatggagagc
aggcacgacagcgagaatgcagagcggatactttacaacatgaggccaaaagaactggtg
gaagtgatcaagaaagcctacatgcaaggcgaagtggaatttgaggatggagaaaatggt
gaggacggagctgcctcccccaggaacgtggggcacaacatctacatattagctcatcag
ttggctcggcataacaaagaactccagaccatgctgaaacctggtggccaagtggatggg
gatgaagctctggagttttatgccaagcacacagcccagatagagattgtcagattagac
cgaaccatggaacagattgtgttccctgtgcccagcatatgtgaattcctaaccaaggag
tcaaaactacgaatatactatactacagagagggatgaacaaggcagcaagatcaatgac
ttcttcctgcggtccgaggacctcttcaatgaaatgaactggcaaaagaaactgagagcc
cagcccgttctgtattggtgtgcccgcaacatgtctttctggagcagcatttcatttaac
ctggctgtcctgatgaacctgcttgtggcgtttttctacccatttaaaggagttcgagga
ggaacactggagccacactggtcaggactgctgtggacagccatgctcatctctctggcc
attgtcattgccctccccaagccccatggcatccgggccttaattgcctccacaattctc
cggttgatattttcggttgggttacaacccacgttgtttcttctgggagctttcaacgtc
tgcaataaaatcatctttctgatgagctttgtgggcaactgtggaacattcaccagaggc
taccgagccatggttctggatgttgagttcctttaccatttgttatatctgctgatctgc
gccatggggctcttcgtccacgagttcttctacagtttgctgctttttgatttggtatac
agagaagagactctgcttaatgtcattaaaagtgtcactcgcaatggccggtccatcatc
ttgacagcagttctggctttgatcctggtttacctgttctcaatagtgggctatcttttc
ttcaaagatgattttatcttggaagtagacaggttgcccaatgaaacagctcttccagaa
gccggagagagtttggcaagcgagttcctgtattctgacgtgtgtagggtggagactggg
gagaactgttcctctcctgcacccaaagaagagctggtcctcacagaagagacggagcaa
gacaaggagcacacgtgtgagacacttctgatgtgcattgtcacggtgctgagtcacggg
ctgaggagcgggggcggagtaggagacgtgctcaggaaaccatccaaagaggagcccctc
tttgctgccagagtaatctatgacctcttgttcttcttcatggtcatcatcatcgtcctt
aatctgattttcggggtcatcattgacacctttgctgacctgaggagtgaaaagcagaag
aaagaggagatcttaaagaccacgtgctttatctgtggcttggaaagagacaagtttgac
aacaagactgtcacctttgaagagcacatcaaggaagaacacaacatgtggcactatctg
tgcttcatcgtgctggtgaaagtgaaggactctacagagtacaccgggcccgagagttat
gtggcagagatgatcaaggaaagaaaccttgactggttccccaggatgagagccatgtcc
ctggtcagcagtgactctgaaggggagcagaatgagctgaggaacctgcaggagaagctg
gagtccaccatgaagcttgtcactaacctttccggccagctgtcagaattaaaggatcag
atgacagaacaaaggaagcagaaacaaagaattggtcttctaggacatcctcctcatatg
aatgtcaacccacagcaaccagcataa

KEGG   Felis catus (domestic cat): 101101230Help
Entry
101101230         CDS       T02385                                 

Gene name
ITPR2
Definition
(RefSeq) inositol 1,4,5-trisphosphate receptor type 2 isoform X1
  KO
K04959  inositol 1,4,5-triphosphate receptor type 2
Organism
fca  Felis catus (domestic cat)
Pathway
fca04020  Calcium signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04070  Phosphatidylinositol signaling system
fca04114  Oocyte meiosis
fca04210  Apoptosis
fca04218  Cellular senescence
fca04270  Vascular smooth muscle contraction
fca04371  Apelin signaling pathway
fca04540  Gap junction
fca04611  Platelet activation
fca04621  NOD-like receptor signaling pathway
fca04625  C-type lectin receptor signaling pathway
fca04720  Long-term potentiation
fca04723  Retrograde endocannabinoid signaling
fca04724  Glutamatergic synapse
fca04725  Cholinergic synapse
fca04726  Serotonergic synapse
fca04728  Dopaminergic synapse
fca04730  Long-term depression
fca04750  Inflammatory mediator regulation of TRP channels
fca04912  GnRH signaling pathway
fca04915  Estrogen signaling pathway
fca04918  Thyroid hormone synthesis
fca04921  Oxytocin signaling pathway
fca04922  Glucagon signaling pathway
fca04924  Renin secretion
fca04925  Aldosterone synthesis and secretion
fca04927  Cortisol synthesis and secretion
fca04928  Parathyroid hormone synthesis, secretion and action
fca04934  Cushing syndrome
fca04970  Salivary secretion
fca04971  Gastric acid secretion
fca04972  Pancreatic secretion
fca05010  Alzheimer disease
fca05163  Human cytomegalovirus infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05170  Human immunodeficiency virus 1 infection
fca05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    101101230 (ITPR2)
   04020 Calcium signaling pathway
    101101230 (ITPR2)
   04070 Phosphatidylinositol signaling system
    101101230 (ITPR2)
   04022 cGMP-PKG signaling pathway
    101101230 (ITPR2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101101230 (ITPR2)
   04210 Apoptosis
    101101230 (ITPR2)
   04218 Cellular senescence
    101101230 (ITPR2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101101230 (ITPR2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101101230 (ITPR2)
   04621 NOD-like receptor signaling pathway
    101101230 (ITPR2)
   04625 C-type lectin receptor signaling pathway
    101101230 (ITPR2)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    101101230 (ITPR2)
   04912 GnRH signaling pathway
    101101230 (ITPR2)
   04915 Estrogen signaling pathway
    101101230 (ITPR2)
   04921 Oxytocin signaling pathway
    101101230 (ITPR2)
   04918 Thyroid hormone synthesis
    101101230 (ITPR2)
   04928 Parathyroid hormone synthesis, secretion and action
    101101230 (ITPR2)
   04924 Renin secretion
    101101230 (ITPR2)
   04925 Aldosterone synthesis and secretion
    101101230 (ITPR2)
   04927 Cortisol synthesis and secretion
    101101230 (ITPR2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101101230 (ITPR2)
  09154 Digestive system
   04970 Salivary secretion
    101101230 (ITPR2)
   04971 Gastric acid secretion
    101101230 (ITPR2)
   04972 Pancreatic secretion
    101101230 (ITPR2)
  09156 Nervous system
   04724 Glutamatergic synapse
    101101230 (ITPR2)
   04725 Cholinergic synapse
    101101230 (ITPR2)
   04728 Dopaminergic synapse
    101101230 (ITPR2)
   04726 Serotonergic synapse
    101101230 (ITPR2)
   04720 Long-term potentiation
    101101230 (ITPR2)
   04730 Long-term depression
    101101230 (ITPR2)
   04723 Retrograde endocannabinoid signaling
    101101230 (ITPR2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101101230 (ITPR2)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101101230 (ITPR2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101101230 (ITPR2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101101230 (ITPR2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101101230 (ITPR2)
   05163 Human cytomegalovirus infection
    101101230 (ITPR2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101101230 (ITPR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:fca04040]
    101101230 (ITPR2)
Ion channels [BR:fca04040]
 Ligand-gated channels
  IP3 receptor
   101101230 (ITPR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ins145_P3_rec RYDR_ITPR MIR RIH_assoc Ion_trans DUF2207 Sec2p
Motif
Other DBs
NCBI-GeneID: 101101230
NCBI-ProteinID: XP_019690290
UniProt: M3W202
Position
B4
AA seq 2701 aa AA seqDB search
MSDKMSSFLYIGDIVSLYAEGSVNGFISTLGLVDDRCVVHPEAGDLANPPKKFRDCLFKV
CPMNRYSAQKQYWKAKQAKQGNHTEAALLKKLQHAAELEQKQNESENKKLLGEIVKYSNV
IQLLHIKSNKYLTVNKRLPALLEKNAMRVSLDAAGNEGSWFYIHPFWKLRSEGDNIVVGD
KVVLMPVNAGQPLHASNIELLDNPGCKEVNAVNCNTSWKITLFMKYSSYREDVLKGGDVV
RLFHAEQEKFLTCDEYEKKQHIFLRTTLRQSATSATSSKALWEIEVVHHDPCRGGAGQWN
SLFRFKHLATGNYLAAELNPDYRDAQNEGKTVRDGDLPTSKKKRQAGEKIMYTLVSVPHG
NDIASLFELDATTLQRADCLVPRNSYVRLRHLCTNTWVTSTSIPIDTDEERPVMLKIGTC
QTKEDKEAFAIVSVPLSEVRDLDFANDANKVLATTVKKLENGTITQNERRFVTKLLEDLI
FFVADVLNNGQEVLDVVIIKPNRERQKLMREQNILAQVFGILKAPFKEKAGEGSMLRLED
LGDQRYAPYKYMLRLCYRVLRHSQQDYRKNQEYIAKNFCVMQSQIGYDILAEDTITALLH
NNRKLLEKHITAKEIETFVSLLRRNREPRFLDYLSDLCVSNTTAIPVTQELICKFMLSPG
NADILIQTKLVSMQVDNPLESSILSDDIDDEEVWLYWIDSNKEPHGKAIRHLAQEAKEGT
KADLEVLTYYRYQLNLFARMCLDRQYLAINQISTQLSVDLILRCVSDESLPFDLRASFCR
LMLHMHVDRDPQESVVPVRYARLWTEIPTKITIHEYDSITDSSRNDMKRKFALTMEFVEE
YLKEVVNQPFPFGDKEKNKLTFEVVHLARNLIYFGFYSFSELLRLTRTLLAILDIVQVPM
SSYFERLSKFQDGGNNVMRTIHGVGEMMTQMVLSRGSIFPMSVPDVQPSIHPSKQGSPVE
PEDVTVMDTKLKIIEILQFILSVRLDYRISYMLSIYKKEFGENNENAEASASGSPDTLLP
SAIVPDIDEIAAQAETMFAGRKEKNPVQLDDEGGRTFLRVLIHLIMHDYPPLLSGALQLL
FKHFSQRAEVLQAFKQVQLLVSNQDVDNYKQIKADLDQLRLTVEKSELWVEKSSSYENGE
MGESQVKGGEEPIEESSILSPVQDGTRKPQIDSNRGNNYRIVKEILIRLSKLCVQNKKCR
NQHQRLLKNMGAHSVVLDLLQIPYEKNDEKMNEVMHLAHTFLQNFCRGNPQNQVLLHKHL
NLFLTPGLLEAETMRHIFMNNYHLCNEISERVVQHFVHCIETHGRHVEYLRFLQTIVKAD
GKYVKKCQDMVMTELINGGEDVLIFYNDRASFPILLHMMCSERDRGDESGPLAYHITLVE
LLAACTEGKNVYTEIKCNSLLPLDDIVRVVTHDDCIPEVKIAYVNFVNHCYVDTEVEMKE
IYTSNHIWKLFENFLVDMARVCNTTTDRKHADIFLEKCVTESIMNIVSGFFNSPFSDNST
SLQTHQPVFIQLLQSAFRIYNCTWPNPAQKSSVESCIRTLAEVAKNRGIAIPVDLDSQVN
TLFLKSHSNMVQRAAMGWRLSARSGPRFKEALGGPAWDYRNIIEKLQDVVASLEQQFSPM
MQAEFSVLVDVLYSPELLFPEGSDARIRCGAFMSKLINHTKKLMEKEEKLCIKILQTLRE
MLEKKDSFVEEGNTLRKILLNRYFKGDYGVGINGHLSGTYSKSAQGGGSFSGQDSDKMGI
SMSDIQCLLDKEGASELVIDVIVNTKNDRIFSEGILLGIALLEGGNTQTQYSFYQQLHEQ
KKSEKFFKVLYDRMKAAQKEIRSTVTVNTIDLGNKKRDDDNELMTSGPRMRVRDSSLLLK
EGMKGQLTEASSATSKAYCAYRREMDPEIDMMCAGSEAGNAEEKSAEEVTMSPAIAIMQP
ILRFLQLLCENHNRELQNFLRNQNNKTNYNLVCETLQFLDCICGSTTGGLGLLGLYINEK
NVVLVNQTLESLTEYCQGPCHENQTCIATHESNGIDIIIALILNDINPLGKYRMDLVLQL
KNNASKLLLAIMESRHDSENAERILFNMRPRELVDVMKNAYNQGLECDHGDDDGGDDGVS
PKDVGHNIYILAHQLARHNKLLQQMLKPGSDPDDGDEALKYYANHTAQIEIVRHDRTMEQ
IVFPVPNICEYLTRESKSRVFNTTERDEQGSKVNDFFQQTEDLYNEMKWQKKIRSNPALF
WFSRHISLWGSISFNLAVFINLAVALFYPFGDDGDEGTLSPLFSVLLWIAVAICTSMLFF
FSKPVGIRPFLVSVMLRSIYTIGLGPTLILLGAANLCNKIVFLVSFVGNRGTFTRGYRAV
ILDMAFLYHVAYVLVCMLGLFVHEFFYSFLLFDLVYREETLLNVIKSVTRNGRSIILTAV
LALILVYLFSIIGFLFLKDDFTMEVDRLKNRTPATGSNEVPTMTLTSMMGTCEKDNCSPT
IPASNTADEEYEDGIERTCDTLLMCIVTVLNQGLRNGGGVGDVLRRPSKDEPLFAARVVY
DLLFYFIVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVSFE
EHIKSEHNMWHYLYFLVLVKVKDPTEYTGPESYVAQMIVEKNLDWFPRMRAMSLVSNEGD
SEQNEIRNLQEKLESTMSLVKQLSGQLAELKEQMTEQRKNKQRLGFLGSNTPHVNHHMPP
H
NT seq 8106 nt NT seq  +upstreamnt  +downstreamnt
atgtctgataaaatgtccagcttcctctacataggggacatcgtgtccctgtacgcggag
ggctcggtcaacggcttcatcagcaccctggggttagtggatgacagatgtgtggtgcac
ccggaggcgggagaccttgccaaccctcccaagaaattcagagactgcctctttaaggtg
tgccctatgaaccgatattctgcccagaaacaatattggaaagctaagcaagccaaacag
gggaaccacacagaggcagccttgctgaagaaattacagcatgctgcggaactggaacaa
aaacaaaatgaatcagagaataagaaactgttgggagaaattgtgaaatacagtaatgtt
atacaactgctacatataaaaagcaacaagtatctgactgtcaacaagagattacctgct
ttattggagaagaacgccatgcgtgtgtccttggatgctgccggaaatgaagggtcttgg
ttttatattcatcccttctggaagctgagaagcgagggtgacaatattgtcgtaggcgac
aaagttgttttgatgcccgtgaatgcaggacaaccactgcatgccagcaacatagagctt
ctggataatccagggtgtaaagaggtgaatgctgttaattgcaacacgagctggaaaatc
actttatttatgaaatatagttcctatcgagaggatgtactaaaaggaggtgatgttgtt
agattgtttcatgcagaacaagagaagtttctgacttgtgatgaatatgagaaaaaacaa
cacattttccttcgtacaaccttgcgtcaatcagccacttctgctactagttctaaagca
ctctgggaaatagaggtagttcatcatgacccttgccgtggcggtgctggacaatggaac
agcttgttcagatttaaacaccttgcaactgggaactatttagctgcagagcttaatcct
gattatcgagatgctcaaaatgaaggaaaaactgtgagagatggagatcttccaacttca
aagaagaaacgccaggcaggggaaaagatcatgtacactttagtctcagtacctcatgga
aatgatattgcatccctctttgaactggatgccacaactcttcagagagctgactgcctg
gtcccaaggaactcatatgttcggttaaggcatttatgtaccaacacgtgggtaacaagt
accagtatccccatagacacagatgaagagaggcctgttatgttaaagattggaacctgc
caaacaaaagaagataaagaagcatttgccattgtgtctgtcccgctgtctgaggtccga
gacttagactttgccaatgatgcaaataaagtgctggcgaccacagttaaaaagctggaa
aatggtacaataactcagaatgaaaggaggtttgtaaccaaattattagaagacctcatc
ttctttgtggctgatgtacttaataacggtcaagaagttttggatgtcgttatcattaag
ccaaaccgagaacgtcaaaagttaatgagggaacaaaacatactggcacaggtatttggg
attcttaaggcaccctttaaggagaaagcaggagaaggctcaatgttgagacttgaagat
ctgggggaccaaagatacgctccttataagtacatgctgaggctgtgttaccgcgtgctc
agacattcgcagcaggactacaggaaaaatcaggaatatattgctaagaatttctgtgtc
atgcagtcccagattggctatgatattttggcagaagataccatcacagctttgttgcac
aacaacagaaaactactagagaaacatatcacagcaaaagaaatagaaacatttgtcagt
ttactcaggagaaatcgcgagccaaggtttttggattacttatcagatctgtgtgtgtct
aatactactgctatacctgtaactcaagaactcatctgtaaatttatgttgagcccaggc
aatgcagacattctcattcaaactaagctggtctcaatgcaagtagacaaccccctggag
agctccatcctttcagatgacattgatgatgaagaagtttggctctactggattgacagc
aacaaggaacctcacggcaaagctatcagacaccttgcacaagaagcgaaagagggcacc
aaagctgatttggaagttcttacctattacaggtaccagctaaacctctttgcaaggatg
tgcttagatcgccagtatctggccataaaccagatttctacgcagctctctgtcgatttg
atcctgcggtgtgtgtcggatgagagcctgccatttgacctccgagcgtctttttgtcgc
ctcatgctccacatgcatgttgaccgggatccccaggagtctgtggtacctgttcgctat
gccaggctctggacagaaatccccacaaagatcacaattcatgaatatgattctataaca
gactcttccagaaatgatatgaagaggaaatttgcactgacaatggaatttgttgaagaa
tacttgaaagaagttgtaaatcagccctttccttttggggataaagaaaaaaacaaactg
acatttgaggtggtccatttggctcggaatcttatatactttggattttatagcttcagt
gaattgctaaggctaacaagaacacttctggctatcctagatattgtacaggtccccatg
tcatcgtattttgaaagactgagcaaatttcaagatggaggaaacaatgtcatgagaacc
atccatggggtgggagagatgatgacccaaatggtactcagtagaggctctatcttcccc
atgagtgtgcctgatgttcagcccagcatccaccccagcaagcaaggaagccctgtagag
cctgaggacgtgaccgtgatggacaccaaactgaagattattgagattttacagtttatc
ctgagtgtcagactggattataggatctcatatatgctgtcaatatataagaaggaattt
ggagagaacaatgaaaacgctgaagcatctgccagtggctctccagatacgttactacca
tcagcgattgttcctgatatagatgaaatcgcagctcaggcagaaacgatgtttgctgga
agaaaggagaaaaatccagttcaacttgatgatgaaggaggcaggacatttttacgggtc
ctcattcatctgatcatgcacgactacccgcctctgctatcaggggccctgcaactactg
ttcaagcactttagccagagagccgaagttttacaggcatttaaacaggtgcaattgctg
gtgtccaatcaagatgtagataactacaagcagatcaaggcggatctagaccagcttcga
ctcactgtagaaaaatctgagttatgggttgagaagagcagcagctatgagaatggagaa
atgggtgaaagtcaagtaaaaggtggtgaagagccaattgaggaatcaagcattttaagt
ccagtgcaggatggaacaaggaagcctcagattgacagcaataggggtaataactaccgg
atcgtgaaggagattttgattagactaagtaaactctgtgtacagaataaaaagtgtcgg
aatcaacatcaacgattactgaaaaatatgggagcccattcggtggtgttggatcttctg
cagataccctatgaaaagaatgacgaaaagatgaatgaagtgatgcatctggcccacaca
ttcctgcagaatttctgtcggggaaatccacagaaccaagttctccttcacaaacatctc
aatttgtttttaactcctggtctccttgaagcagaaaccatgcggcacatcttcatgaac
aattaccatctctgcaatgagatcagcgagagggtagtacaacactttgtgcactgcatt
gagacacatggccgccacgtggagtacctgaggtttttgcaaacgattgtaaaagcagat
ggcaaatatgtgaagaaatgccaggatatggtaatgacagagttgataaatgggggtgaa
gatgtgctgatattttacaatgatagagcctcatttcccatccttctccatatgatgtgt
tcagagagagaccgaggggatgagagtggccccttagcttaccacatcacgctggtggag
ttgctggcagcatgtacagaggggaaaaatgtctacactgaaatcaagtgcaattccctt
ctgcccttggacgacatagtaagggtggtgacccatgatgactgcatccctgaggttaaa
attgcttatgtgaatttcgttaatcactgttatgtggacacagaagtggaaatgaaagaa
atctacacaagtaaccacatttggaagttatttgagaacttcttggtggatatggcaagg
gtttgcaacacaaccacagacaggaaacacgcagacatcttcttggagaagtgtgttacc
gagtcaataatgaacatagtgagcggcttctttaattccccattttcagacaacagtacc
agcctccagacacatcagccagtttttattcagctgcttcaatctgccttcaggatttac
aattgcacctggccaaatccagcacagaaatcatctgtggagtcttgcatcagaactttg
gctgaagtggcaaagaatcgcgggattgccattccagtggatttggacagccaagtgaat
actcttttcctgaagagccattctaatatggtgcagagagcagctatgggttggagacta
tctgctcgctctggaccacgttttaaggaagctcttggagggcctgcttgggattataga
aacatcattgaaaagttacaggatgtcgtggcctccttggaacaacagttcagcccaatg
atgcaggctgagttctcggtgttggttgatgtgttgtatagtccagaactactgttccct
gaggggagtgatgcaagaataagatgtggtgctttcatgtccaagttgattaatcataca
aagaaactgatggagaaggaagaaaagttgtgcattaaaattctccagactttacgagaa
atgctagagaagaaagacagctttgtggaagagggtaacacattaagaaaaatactcctg
aatcgctactttaaaggagactatggagttggtatcaatggacacctctctggaacctac
agcaaatctgcacaagggggagggagcttttcgggacaagattcagataagatggggata
tcaatgtcagacattcagtgtctactggataaagaaggtgcatctgaacttgtcattgat
gttatagtgaacaccaaaaatgacagaattttttcagaaggaattttacttggcattgcc
ttgctcgaaggaggaaatacacaaactcagtactccttctaccagcaattacatgaacaa
aaaaagtcagaaaaattcttcaaagttctgtatgaccgaatgaaggctgctcagaaagag
ataagatcaacagtgaccgttaataccatagacttaggtaacaaaaaaagggatgatgac
aatgaattgatgacatctggtccacgaatgagagtaagagattcatcattacttttaaaa
gagggaatgaaagggcaattaacagaagcttcttcggcaacctccaaagcgtattgtgca
taccgaagagaaatggatccagaaatcgacatgatgtgtgcaggatccgaagcaggaaat
gccgaggaaaagtctgccgaggaagtaaccatgagtcctgcaattgccatcatgcagccc
atactgaggtttctgcagttgctgtgtgagaatcacaatcgggagctgcagaacttcttg
aggaatcaaaacaacaaaacaaattataaccttgtctgtgagacccttcagtttttggac
tgcatttgtggaagtaccaccggtggcctgggcctgttgggtctctacatcaatgagaag
aatgtagtgctggtcaaccagactctggagagcttgacggagtattgccagggcccatgc
catgaaaatcagacgtgtattgctactcatgaatccaatgggattgatatcatcattgct
ttgattctaaatgacataaaccctcttggtaaatatcgaatggatctggtgctccaacta
aagaacaatgcctccaagctcttgctggccatcatggaaagcagacacgacagtgagaat
gcggaaagaattctttttaacatgagacccagggaactggtggatgtgatgaagaacgcc
tataaccaaggattggaatgtgaccatggggatgatgatggaggagatgacggtgtttcc
ccaaaagatgttggacacaatatctatattctggcccatcagttggcccgtcacaacaaa
ctcttacaacagatgctcaaaccaggatcagatccagatgatggggatgaagcgttaaaa
tattatgccaatcacactgcacagattgagattgttcggcatgataggacaatggaacaa
atagtttttcctgtccccaatatatgtgaataccttacgcgggaatccaagagccgtgtg
ttcaacacaactgaaagggatgaacaaggaagtaaagtgaatgactttttccagcaaact
gaagatctctacaatgaaatgaagtggcagaagaaaatcaggagtaaccctgccctgttc
tggttctcaaggcatatatccctgtgggggagcatttccttcaacttggctgtgttcatc
aatttagctgttgctctcttctacccatttggggatgatggagatgaaggtacgctttcc
ccgttgttctcagttctactttggatagcagttgcaatctgcacatcgatgctgtttttc
ttctccaagcctgtgggtattcggccatttcttgtgtcagtaatgctcagatcaatatat
acaataggtcttgggcctacattaatacttcttggtgcagctaatctttgtaataaaata
gtgtttctggtgagttttgtgggaaatcgtggcactttcacccgaggctaccgagcggtc
atcctggatatggcctttctctaccacgtggcgtatgtcctggtttgcatgctgggcctc
tttgtccatgaattcttctatagcttcctgctgtttgatttggtgtacagagaagagact
ctgctcaatgtcataaagagtgtcacacggaatggccgctccattattctaactgcagtc
ctggctctcatccttgtctacctgttttccattattgggttcctttttctgaaggatgac
ttcacaatggaagtggataggctgaaaaacagaactcccgctacagggagtaatgaagtt
cctactatgactttaacttcaatgatgggaacatgtgaaaaggacaactgctcacccact
ataccagcttcgaatacagcagatgaagagtatgaagatggaattgaaaggacgtgtgac
acgctccttatgtgcattgtcactgtcctgaaccagggcctcaggaatggcggcggcgtg
ggagatgttctgagaaggccatcgaaagatgagcccttgtttgctgcccgagtggtatat
gaccttcttttttatttcattgttatcatcatcgttcttaacttgatttttggtgttatc
attgatacttttgctgatctcagaagtgaaaaacagaaaaaggaagaaattctaaagaca
acatgtttcatctgtggacttgagagggacaagtttgataacaaaactgtttcatttgag
gaacacatcaagtcagaacacaacatgtggcattatttgtacttcctagtcctggtgaag
gttaaagaccccactgaatacactgggcctgaaagttatgtggctcaaatgattgtggag
aagaatttagactggtttcctcggatgcgagccatgtccctcgtcagcaatgaaggtgac
agcgagcaaaatgagattcggaacctgcaggagaagttggaatccaccatgagtctggtc
aaacagctgtctggtcagctagcagagctcaaggagcagatgacagaacaaaggaagaat
aagcagagactgggctttctcggatcaaacacaccccatgtgaatcatcacatgccacca
cactga

DBGET integrated database retrieval system