KEGG   Felis catus (domestic cat): 101088077Help
Entry
101088077         CDS       T02385                                 

Gene name
LEF1
Definition
(RefSeq) lymphoid enhancer-binding factor 1 isoform X2
  KO
K04492  lymphoid enhancer-binding factor 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04310  Wnt signaling pathway
fca04390  Hippo signaling pathway
fca04520  Adherens junction
fca04916  Melanogenesis
fca04934  Cushing syndrome
fca05200  Pathways in cancer
fca05210  Colorectal cancer
fca05213  Endometrial cancer
fca05215  Prostate cancer
fca05216  Thyroid cancer
fca05217  Basal cell carcinoma
fca05221  Acute myeloid leukemia
fca05224  Breast cancer
fca05225  Hepatocellular carcinoma
fca05226  Gastric cancer
fca05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Module
fca_M00677  Wnt signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101088077 (LEF1)
   04390 Hippo signaling pathway
    101088077 (LEF1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    101088077 (LEF1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    101088077 (LEF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101088077 (LEF1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101088077 (LEF1)
   05225 Hepatocellular carcinoma
    101088077 (LEF1)
   05226 Gastric cancer
    101088077 (LEF1)
   05216 Thyroid cancer
    101088077 (LEF1)
   05221 Acute myeloid leukemia
    101088077 (LEF1)
   05217 Basal cell carcinoma
    101088077 (LEF1)
   05215 Prostate cancer
    101088077 (LEF1)
   05213 Endometrial cancer
    101088077 (LEF1)
   05224 Breast cancer
    101088077 (LEF1)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    101088077 (LEF1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101088077 (LEF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    101088077 (LEF1)
Transcription factors [BR:fca03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    101088077 (LEF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Motif
Other DBs
NCBI-GeneID: 101088077
NCBI-ProteinID: XP_006930988
Ensembl: ENSFCAG00000027039
UniProt: A0A337SI72
Position
B1
AA seq 400 aa AA seqDB search
MPQLSGAGGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVN
ESEIIPASNGHEVARQAQTSQESYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPN
MNNDPYMSNGSLSPPIPRTSNKVPVVQPSHAVHPLTPLITYSDEHFSPGSHPSHLPSDVN
SKQGMSRHPPAPEIPTFYPLSPGGVGQITPPLGWQGQPVYPITGGFRQPYPSSLSVDTSM
SRFSHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDSDLMHVKPQHEQRKEQEPKRPHI
KKPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLH
MQLYPGWSARDNYGKKKKRKREKLQESTSGTGPRMTAAYI
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgccccaactctccggggccggcggcggcggcggcgggggagacccggaactctgcgcc
accgacgagatgatccccttcaaggatgagggcgatcctcagaaggagaaaatcttcgcc
gagatcagtcaccccgaagaggaaggcgacttagccgacatcaagtcctccttggttaat
gagtctgaaatcatcccggccagcaacggacacgaggtggccagacaagcacaaacctct
caggagtcctaccacgacaaggccagagaacaccctgatgacggaaagcatccagatgga
ggcctctacaacaagggaccctcctactcaagttattccgggtacataatgatgccaaat
atgaataatgacccatacatgtcaaatggatctctttctccacccatcccaagaacatca
aataaggtgcctgtggtgcagccatcacatgcggtccatcctcttaccccccttatcacg
tacagcgacgagcacttttctccaggatcacacccctcacacctcccttcagatgtcaac
tccaaacaaggcatgtccagacatcctccagctcctgagatccctaccttttatcctctg
tctccaggtggtgttggacagattaccccacctcttggctggcaaggtcagcctgtatat
cccatcacgggaggattcaggcaaccctacccatcctcactgtcagtcgacacttccatg
tccaggttttcccatcatatgattcctggtcctcctggtccccacacaactggcatccct
catccagctatcgtaacgcctcaggtcaaacaggaacatccccacactgacagtgaccta
atgcacgtgaagcctcagcatgaacagagaaaggaacaggagccaaaaagacctcacatt
aagaagcctctgaacgcttttatgttatacatgaaagaaatgagagcgaatgttgtagct
gagtgtactctaaaagaaagtgcagctatcaaccagattctgggcagaaggtggcatgcc
ctttcccgtgaagagcaggctaaatattatgaattagcacggaaggaaagacagctacat
atgcagctctatccaggctggtctgcaagagacaattatggtaagaaaaagaagaggaag
agagagaaactccaggagtcgacatcaggtacaggtcccagaatgacagctgcctacatc
tga

KEGG   Felis catus (domestic cat): 101089850Help
Entry
101089850         CDS       T02385                                 

Gene name
TCF7L1
Definition
(RefSeq) transcription factor 7-like 1 isoform X1
  KO
K04490  transcription factor 7-like 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04310  Wnt signaling pathway
fca04390  Hippo signaling pathway
fca04520  Adherens junction
fca04916  Melanogenesis
fca04934  Cushing syndrome
fca05165  Human papillomavirus infection
fca05200  Pathways in cancer
fca05210  Colorectal cancer
fca05213  Endometrial cancer
fca05215  Prostate cancer
fca05216  Thyroid cancer
fca05217  Basal cell carcinoma
fca05221  Acute myeloid leukemia
fca05224  Breast cancer
fca05225  Hepatocellular carcinoma
fca05226  Gastric cancer
fca05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Module
fca_M00677  Wnt signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101089850 (TCF7L1)
   04390 Hippo signaling pathway
    101089850 (TCF7L1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    101089850 (TCF7L1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    101089850 (TCF7L1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101089850 (TCF7L1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101089850 (TCF7L1)
   05225 Hepatocellular carcinoma
    101089850 (TCF7L1)
   05226 Gastric cancer
    101089850 (TCF7L1)
   05216 Thyroid cancer
    101089850 (TCF7L1)
   05221 Acute myeloid leukemia
    101089850 (TCF7L1)
   05217 Basal cell carcinoma
    101089850 (TCF7L1)
   05215 Prostate cancer
    101089850 (TCF7L1)
   05213 Endometrial cancer
    101089850 (TCF7L1)
   05224 Breast cancer
    101089850 (TCF7L1)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    101089850 (TCF7L1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101089850 (TCF7L1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101089850 (TCF7L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    101089850 (TCF7L1)
Transcription factors [BR:fca03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    101089850 (TCF7L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Motif
Other DBs
NCBI-GeneID: 101089850
NCBI-ProteinID: XP_023107589
Ensembl: ENSFCAG00000003376
Position
A3
AA seq 587 aa AA seqDB search
MPQLGGGGGGGGGGGGGGSGAGAAGGGDDLGANDELIPFQDEGGEEQEPSSDSASAQRDL
DEVKSSLVNESENQSSSSDSEAERRPQPARDAFQKPRDYFAEVRRPQDGAFFKGPPYPGY
PFLMIPDLSSPYLSNGPLSPGGARTYLQMKWPLLDVPSSATVKDTRSPSPAHLSNKVPVV
QPPHHMHPLTPLITYSNDHFSPGSPPTHLSPEIDPKTAGIPRPPHPSELSPYYPLSPGAV
GQIPHPLGWLVPQQGQPMYSLPPGGFRHPYPALAMNASMSSLVSSRFSPHMVAPAHPGLP
TSGIPHPAIVSPIVKQEPAPPSLSPAVSAKSPVTVKKEEEKKPHVKKPLNAFMLYMKEMR
AKVVAECTLKESAAINQILGRKWHNLSREEQAKYYELARKERQLHSQLYPTWSARDNYGK
KKKRKREKQLSQTQSQQQVQEAEGALASKSKKPCVQYLPPEKSCDSPASSHGSMLDSPAT
PSAALASPAAPAATHSEQAQPLSLTTKPESRAQLALHSAAFLSAKATATSSGQMGSQPPL
LSRPLPLGSLPTALLASPPSFPTTLHAHQALPVLQAQPLSLVTKSAH
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgccccagctcggcggcggcggcggcgggggaggcggcgggggcggcggcggctcgggc
gccggggcggccggcggaggggacgacctcggggcgaacgacgagctgatccccttccaa
gacgaggggggcgaggagcaggagccgagcagcgacagtgcctcggcgcagcgggacctg
gacgaggtcaagtcgtccctggtcaacgagtcggagaaccagagcagcagctcggactcg
gaggcggagaggcgcccgcagcccgcccgggacgccttccagaagccgcgggactatttc
gccgaagtgagaaggccccaggacggcgcgttctttaagggccccccgtaccctgggtac
ccgttcctgatgattccggacttgagcagtccgtacctctccaacggacccctgtctccg
ggaggagcgcgcacgtacctacagatgaaatggcccctcctcgatgtcccatccagtgcc
acagtcaaggacaccaggtcaccatccccggcacacttgtctaataaagttcctgttgtt
cagcccccgcatcacatgcacccgttgacgcccctcatcacctacagcaacgaccacttc
tcccctggctcccctcccacacatctctccccagagatcgatccaaagacagcaggaatc
ccccggccccctcacccatctgagctgtctccatattacccactgtctcctggagctgtc
ggacaaatccctcatcctctcggctggctcgtcccgcagcaaggacagcccatgtactcc
cttcctcctggtggcttccggcacccctaccctgccctcgccatgaacgcctcaatgtcc
agcctggtttccagtcggttctctcctcacatggtggctccggcccatcctggtctgccc
acctcagggattccccaccccgccatcgtctcccccattgtcaagcaggagccagcaccc
cccagcctgagccccgccgtgagcgcgaaatcaccagtcacggtgaaaaaggaggaagaa
aagaaaccccacgtgaagaagcctcttaatgccttcatgttatatatgaaggagatgagg
gccaaggtggtggccgagtgcaccctgaaggagagcgcggccattaaccaaatcctggga
agaaagtggcacaacttgtcccgagaagaacaggccaagtactatgaactggcccggaag
gagcggcaacttcactcccagctctacccgacctggtcagcccgggacaactacggtaag
aaaaagaagaggaagagagaaaagcagctgtcacagacacagtcccagcagcaagtccaa
gaggcagagggtgctctggcctccaagagcaagaagccatgtgttcagtacctgcccccc
gagaagtcgtgtgacagccctgcctcttcccacggcagcatgctcgactccccggccacc
ccctccgcggccttggcgtcgcctgctgcccctgctgcaacccactcggagcaagcccag
cccctctccctcaccaccaagccggagagccgggcccagctggctctacactcggccgcc
ttcctgtccgctaaggcgacagccacctcctctggccagatgggcagccagcccccactc
ctctcccggcccctccccctcgggtccctgcccacagctctgctggcttcccccccctcc
ttccccaccacactccatgcccaccaggccctcccggtcctccaggcccagcctctttcc
ttggttaccaagtctgcccactga

KEGG   Felis catus (domestic cat): 101095618Help
Entry
101095618         CDS       T02385                                 

Gene name
TCF7L2
Definition
(RefSeq) transcription factor 7-like 2 isoform X1
  KO
K04491  transcription factor 7-like 2
Organism
fca  Felis catus (domestic cat)
Pathway
fca04310  Wnt signaling pathway
fca04390  Hippo signaling pathway
fca04520  Adherens junction
fca04916  Melanogenesis
fca04934  Cushing syndrome
fca05165  Human papillomavirus infection
fca05200  Pathways in cancer
fca05210  Colorectal cancer
fca05213  Endometrial cancer
fca05215  Prostate cancer
fca05216  Thyroid cancer
fca05217  Basal cell carcinoma
fca05221  Acute myeloid leukemia
fca05224  Breast cancer
fca05225  Hepatocellular carcinoma
fca05226  Gastric cancer
fca05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Module
fca_M00677  Wnt signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101095618 (TCF7L2)
   04390 Hippo signaling pathway
    101095618 (TCF7L2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    101095618 (TCF7L2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    101095618 (TCF7L2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101095618 (TCF7L2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101095618 (TCF7L2)
   05225 Hepatocellular carcinoma
    101095618 (TCF7L2)
   05226 Gastric cancer
    101095618 (TCF7L2)
   05216 Thyroid cancer
    101095618 (TCF7L2)
   05221 Acute myeloid leukemia
    101095618 (TCF7L2)
   05217 Basal cell carcinoma
    101095618 (TCF7L2)
   05215 Prostate cancer
    101095618 (TCF7L2)
   05213 Endometrial cancer
    101095618 (TCF7L2)
   05224 Breast cancer
    101095618 (TCF7L2)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    101095618 (TCF7L2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101095618 (TCF7L2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101095618 (TCF7L2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    101095618 (TCF7L2)
Transcription factors [BR:fca03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    101095618 (TCF7L2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Motif
Other DBs
NCBI-GeneID: 101095618
NCBI-ProteinID: XP_023096693
Position
D2
AA seq 678 aa AA seqDB search
MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENSSAERDLADVKSSLVNESETNQNSSS
DSEAERRPPPRSESFRDKSRESLEEAAKRQDGGLFKGPPYPGYPFIMIPDLTSPYLPNGS
LSPTARTLHFQSGSTHYSAYKTIEHQIAIQYLQMKWPLLDVQAGTLQSRQALKDARSPSP
AHIVQCPLPCCTQGHDCQHLYPPSDFTVSTQVFRDMKRSHSLQKVGEPWCLESNKVPVVQ
HPHHVHPLTPLITYSNEHFTPGNPPPHLPADVDPKTGIPRPPHPPDISPYYPLSPGTVGQ
IPHPLGWLVPQQGQPVYPITTGGFRHPYPTALTVNASMSSFLSSRFPPHMVPPHHTLHTT
GIPHPAIVTPTVKQESSQSDVGSLHSSKHQDSKKEEEKKKPHIKKPLNAFMLYMKEMRAK
VVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKK
KRKRDKQPGETNEHSECFLNPCLSLPPITDLSAPKKCRARFGLDQQNNWCGPCRRKKKCV
RYIQGEGSCLSPPSSDGSLLDSPPPSPNLLGSPPQDAKSQTEQTQPLSLSLKPDPLAHLP
MMPPPPALLLAEAAHGKAPALCPNGALDLPPAALQPPVLSASSLAQPSTSSLHSHSAVAV
AVAGTQPQPLSLVTKSLE
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
atgccgcagctgaacggcggtggaggagatgacctaggcgccaacgacgaactgatttcc
ttcaaagacgagggcgagcaggaggagaagagctccgaaaactcctcggcagagagggat
ttagctgatgtcaaatcgtctctagtcaatgaatcagaaacgaatcaaaacagctcctcc
gattccgaggcggaaagacggcctccgcctcgctccgaaagtttccgagataaatcccgg
gaaagtttggaagaagcggccaagaggcaagatggagggctctttaaggggccaccgtat
cccggctaccccttcatcatgatccccgacctgacgagcccctacctccccaacggatcg
ctctcgcccaccgcccgaaccctccattttcagtccgggagcacacattactctgcgtac
aaaacgattgaacaccagattgcaattcagtatctccagatgaaatggccactgcttgat
gtccaggcggggaccctccagagcagacaagccctcaaggatgcccgctctccgtcaccg
gcacacattgtccagtgccccctcccttgctgcactcagggacatgactgtcagcacctc
taccccccctcagacttcactgtcagcactcaagtcttcagggacatgaaaaggagccac
tccctacaaaaggttggggagccctggtgtttggagtcgaacaaagtaccggttgtgcaa
caccctcaccatgtccaccctctcacgccgctcatcacgtacagcaacgaacacttcacc
ccgggaaacccacctccacacttaccagccgacgtagaccccaaaacaggaatcccacgg
cctccgcaccctccagatatatctccgtattacccactatcgcccggcaccgtaggacaa
atcccccatccgctaggatggttagtaccacagcaaggtcagcccgtgtacccaatcacg
acaggaggattccgtcacccctaccccacggctctgactgtcaacgcctccatgtctagc
ttcctgtcttccaggttccctccccatatggtcccaccacatcacactctacacacgacc
ggcatcccccacccggccatagtaacgccaaccgtcaaacaggaatcctcccagagtgac
gtcggctcactccatagctcaaagcatcaggactccaaaaaggaagaagaaaagaagaag
ccccacataaagaaacctcttaacgcgttcatgttgtatatgaaggaaatgagggccaag
gtcgtggccgagtgcacgttgaaagaaagtgccgccatcaaccagatcctggggcgaagg
tggcacgcgctgtccagagaagagcaagcgaaatactacgagctggcccggaaggagcga
cagcttcacatgcagctgtaccccggctggtctgcgcgggataactatgggaagaagaag
aagaggaaaagggacaagcagccaggagagaccaatgaacacagcgaatgtttcctaaat
ccttgcctttcacttcctccgattacagacctgagcgctcctaagaaatgccgagcgcgc
tttggccttgatcaacagaataactggtgcggcccttgcaggagaaaaaaaaagtgcgtt
cgctacatacaaggtgaaggcagctgcctcagtccaccctcttcagatggaagcttacta
gactcgcctcctccctcccccaacctgctaggctcccctccccaagacgccaagtcacag
actgagcagacccagcctctctcgctgtccctgaagcccgaccccctggcccacctgccc
atgatgccgccgccgcccgccctcctgcttgccgaggccgcccacggcaaggcccccgcc
ctctgtcccaacggggccctggacctgccccccgccgccctgcagccgcccgtcctgtcc
gcctcgtctctggcgcagccgtcgacatcttccttacattcccacagcgccgtggccgtg
gccgtggccgggacgcagccccagccgctgtccctcgtgaccaagtctttagaatag

KEGG   Felis catus (domestic cat): 101098768Help
Entry
101098768         CDS       T02385                                 

Gene name
TCF7
Definition
(RefSeq) transcription factor 7 isoform X1
  KO
K02620  transcription factor 7
Organism
fca  Felis catus (domestic cat)
Pathway
fca04310  Wnt signaling pathway
fca04390  Hippo signaling pathway
fca04520  Adherens junction
fca04550  Signaling pathways regulating pluripotency of stem cells
fca04916  Melanogenesis
fca04934  Cushing syndrome
fca05165  Human papillomavirus infection
fca05200  Pathways in cancer
fca05210  Colorectal cancer
fca05213  Endometrial cancer
fca05215  Prostate cancer
fca05216  Thyroid cancer
fca05217  Basal cell carcinoma
fca05221  Acute myeloid leukemia
fca05224  Breast cancer
fca05225  Hepatocellular carcinoma
fca05226  Gastric cancer
fca05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Module
fca_M00677  Wnt signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101098768 (TCF7)
   04390 Hippo signaling pathway
    101098768 (TCF7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    101098768 (TCF7)
   04550 Signaling pathways regulating pluripotency of stem cells
    101098768 (TCF7)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    101098768 (TCF7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101098768 (TCF7)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101098768 (TCF7)
   05225 Hepatocellular carcinoma
    101098768 (TCF7)
   05226 Gastric cancer
    101098768 (TCF7)
   05216 Thyroid cancer
    101098768 (TCF7)
   05221 Acute myeloid leukemia
    101098768 (TCF7)
   05217 Basal cell carcinoma
    101098768 (TCF7)
   05215 Prostate cancer
    101098768 (TCF7)
   05213 Endometrial cancer
    101098768 (TCF7)
   05224 Breast cancer
    101098768 (TCF7)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    101098768 (TCF7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101098768 (TCF7)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101098768 (TCF7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    101098768 (TCF7)
Transcription factors [BR:fca03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    101098768 (TCF7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Motif
Other DBs
NCBI-GeneID: 101098768
NCBI-ProteinID: XP_023110936
Ensembl: ENSFCAG00000008424
Position
A1
AA seq 567 aa AA seqDB search
MPQLDSGGGGAGGGDDLGAPDELLAFQDEGEEQDDKSRDSAAGPERDLAELKSSLVNESE
GAAGGAGVPGAGAGARGEAEVGAEALGREHASQRLFPDKLPESLEDGLKAPECASGMYKD
TVYSAFNLLMHYPPPSGAGQHPQPQPPLHNKASQPAHSVPQLSPLYEHFSSPHPTPAPAD
ISQKQGVHRPLQTPDLSGFYSLTSGSMGQLPHTVSWPSPPLYPLSPSCGYRQHFPAPTAA
PGAPYPRFTHPSLMLGSGVPGHPAAIPHPAIVPPSGKQELQPYDRSLKTQAESKAEKEAK
KPTIKKPLNAFMLYMKEMRAKVIAECTLKESAAINQILGRRWHALSREEQAKYYELARKE
RQLHMQLYPGWSARDNYGKKKRRSREKHQESNTDPGSPKKCRARFGLNQQTDWCGPCRRK
KKCIRYLPGEGRCPSPVPSDDSALGCPGSPAPQDSPSYLLLPHFPTELLASPAEPAPTSP
GLSAALSLPAPWTPTGPPQRPAEYTAATTGISETGSLACTGHLAASRGSSSERKRQSPKA
RGNWPGALLPPSQGPGPGDFRGCTSSA
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgccgcagctggactcgggcgggggcggcgcgggcgggggcgacgacctcggcgcgcct
gacgagctgctggccttccaggacgagggcgaggagcaggacgacaagagccgcgacagc
gccgcgggccccgagcgcgacctggccgagctcaagtcgtcgctggtcaatgagtccgag
ggcgcggcgggcggcgcgggggtccctggggccggtgccggggcccgcggcgaggcggag
gtcggggccgaggctctcgggcgggaacacgcgtcgcagagacttttccccgacaaactt
ccagagtctctggaagacggcctgaaggccccggagtgcgccagcggcatgtacaaagac
accgtctactcggccttcaatctgcttatgcactacccacccccttcgggagcagggcag
cacccccagccgcagcccccactgcacaacaaggccagtcagccagcccacagcgtccca
cagctctctcctctctatgaacatttcagcagcccacaccctacacctgcaccagccgac
atcagccagaagcaaggagttcacaggcctctgcagacccctgacctctctggcttctac
tctctgacctcaggcagcatgggacagcttccccacactgtgagctggcccagccctcct
ctctaccccctgtccccttcctgcggatatagacagcacttccctgcccccactgcagcc
cctggcgccccctaccccaggttcacccacccatccctgatgctaggctctggtgtgcct
ggtcaccctgcagccatcccccacccggctatcgtacctccctcaggcaagcaggagctg
cagccatatgaccgtagcctgaagacacaggcagagtccaaggcagagaaagaggccaag
aagccaaccatcaagaagccactcaacgccttcatgctgtacatgaaggagatgagagcc
aaggtcattgcagagtgtacactcaaggagagtgctgccatcaaccagatcctgggccgc
aggtggcacgcgctgtctcgggaagagcaggccaagtattatgagctggcccgaaaagag
aggcagctgcacatgcagctctacccaggctggtcggcgcgggacaactatgggaagaaa
aagaggcggtcacgagaaaagcaccaggagtccaacacagaccctggctcgcctaagaaa
tgccgtgctcgctttggcctcaaccagcagacggattggtgtggtccgtgcaggaggaaa
aagaaatgcattcggtacttacccggagaaggccgctgccccagcccagttccttccgat
gacagtgctctaggctgccccgggtccccagccccccaggactcgccctcatacctcctg
ctaccccactttcccacagaactgcttgctagccctgcggagccggcgcctacatcacca
ggtctctcggccgctctcagcctcccagccccctggaccccaacaggccccccacagcgt
cctgcagagtacacagctgcaacaacaggaatctcagagacaggcagcctagcatgtaca
ggacacctggccgcctccaggggctcatcctctgagaggaagcgacagagccccaaagca
cgtgggaactggccaggggccctgttacctccctctcagggaccgggcccaggagacttc
cgaggctgcacaagttctgcctga

DBGET integrated database retrieval system