KEGG   Felis catus (domestic cat): 101088122Help
Entry
101088122         CDS       T02385                                 

Definition
(RefSeq) cytochrome c-like
  KO
K08738  cytochrome c
Organism
fca  Felis catus (domestic cat)
Pathway
fca01524  Platinum drug resistance
fca04115  p53 signaling pathway
fca04210  Apoptosis
fca04215  Apoptosis - multiple species
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05014  Amyotrophic lateral sclerosis (ALS)
fca05016  Huntington disease
fca05134  Legionellosis
fca05145  Toxoplasmosis
fca05152  Tuberculosis
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05162  Measles
fca05163  Human cytomegalovirus infection
fca05164  Influenza A
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05200  Pathways in cancer
fca05210  Colorectal cancer
fca05222  Small cell lung cancer
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101088122
   04215 Apoptosis - multiple species
    101088122
   04115 p53 signaling pathway
    101088122
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101088122
  09162 Cancer: specific types
   05210 Colorectal cancer
    101088122
   05222 Small cell lung cancer
    101088122
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101088122
   05012 Parkinson disease
    101088122
   05014 Amyotrophic lateral sclerosis (ALS)
    101088122
   05016 Huntington disease
    101088122
  09166 Cardiovascular disease
   05416 Viral myocarditis
    101088122
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101088122
  09171 Infectious disease: bacterial
   05134 Legionellosis
    101088122
   05152 Tuberculosis
    101088122
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101088122
   05162 Measles
    101088122
   05164 Influenza A
    101088122
   05161 Hepatitis B
    101088122
   05160 Hepatitis C
    101088122
   05168 Herpes simplex virus 1 infection
    101088122
   05163 Human cytomegalovirus infection
    101088122
   05167 Kaposi sarcoma-associated herpesvirus infection
    101088122
   05169 Epstein-Barr virus infection
    101088122
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101088122
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    101088122
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C
Motif
Other DBs
NCBI-GeneID: 101088122
NCBI-ProteinID: XP_011286768
Position
D4
AA seq 93 aa AA seqDB search
MGDVEQGKIFVQKCAQHHDAEKGGKHKTGPNLHGLFGWKAGQTPGFSYMDANQNKGTSWG
EETLTEYLENPEKYIPETKMIFAGIKKARERAD
NT seq 282 nt NT seq  +upstreamnt  +downstreamnt
atgggtgacgttgagcagggcaagatttttgttcagaagtgtgcccagcaccatgacgcg
gaaaagggaggcaagcacaagactgggccaaatctccatggtttatttgggtggaaggca
ggtcaaacccctggattttcttacatggatgccaaccagaacaaaggcacctcctgggga
gaggagacactgacggagtatttggagaatcccgagaagtacatccctgaaacaaaaatg
atctttgctggcatcaagaaggcaagggaaagagcagactag

KEGG   Felis catus (domestic cat): 101094614Help
Entry
101094614         CDS       T02385                                 

Definition
(RefSeq) cytochrome c, testis-specific-like
  KO
K08738  cytochrome c
Organism
fca  Felis catus (domestic cat)
Pathway
fca01524  Platinum drug resistance
fca04115  p53 signaling pathway
fca04210  Apoptosis
fca04215  Apoptosis - multiple species
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05014  Amyotrophic lateral sclerosis (ALS)
fca05016  Huntington disease
fca05134  Legionellosis
fca05145  Toxoplasmosis
fca05152  Tuberculosis
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05162  Measles
fca05163  Human cytomegalovirus infection
fca05164  Influenza A
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05200  Pathways in cancer
fca05210  Colorectal cancer
fca05222  Small cell lung cancer
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101094614
   04215 Apoptosis - multiple species
    101094614
   04115 p53 signaling pathway
    101094614
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101094614
  09162 Cancer: specific types
   05210 Colorectal cancer
    101094614
   05222 Small cell lung cancer
    101094614
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101094614
   05012 Parkinson disease
    101094614
   05014 Amyotrophic lateral sclerosis (ALS)
    101094614
   05016 Huntington disease
    101094614
  09166 Cardiovascular disease
   05416 Viral myocarditis
    101094614
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101094614
  09171 Infectious disease: bacterial
   05134 Legionellosis
    101094614
   05152 Tuberculosis
    101094614
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101094614
   05162 Measles
    101094614
   05164 Influenza A
    101094614
   05161 Hepatitis B
    101094614
   05160 Hepatitis C
    101094614
   05168 Herpes simplex virus 1 infection
    101094614
   05163 Human cytomegalovirus infection
    101094614
   05167 Kaposi sarcoma-associated herpesvirus infection
    101094614
   05169 Epstein-Barr virus infection
    101094614
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101094614
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    101094614
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-GeneID: 101094614
NCBI-ProteinID: XP_003990999
Position
C1
AA seq 132 aa AA seqDB search
MRLAEKEWAPQSCDPSAHWLRADADRRGDAKAGEKIFIQKCAQCHTVEKGGKHKTGPNLW
GLSGPGRKTGQAPGFSFSDANKNRGIIWGEETLIEYLENPKEYIPGTKMVFAGLKKSERD
DLIQYLKQATSS
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgagactggctgagaaggagtgggcaccgcagtcttgtgatccgagcgctcactggtta
cgggccgatgcagatagaaggggagatgctaaagcaggtgagaagatctttattcagaaa
tgtgctcagtgccacacagtggaaaaaggtggaaaacacaagactggtccaaatctctgg
ggcctttctggccctggacgaaaaacaggacaagcaccaggattttctttttccgatgct
aacaaaaacagaggtattatctggggagaggaaactctgatagaatatttagagaaccca
aaggaatatatccctggaactaaaatggtctttgctggtcttaaaaagagtgagagagat
gatctcattcagtatttgaaacaggcaacatcttcatga

KEGG   Felis catus (domestic cat): 101098213Help
Entry
101098213         CDS       T02385                                 

Definition
(RefSeq) cytochrome c
  KO
K08738  cytochrome c
Organism
fca  Felis catus (domestic cat)
Pathway
fca01524  Platinum drug resistance
fca04115  p53 signaling pathway
fca04210  Apoptosis
fca04215  Apoptosis - multiple species
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05014  Amyotrophic lateral sclerosis (ALS)
fca05016  Huntington disease
fca05134  Legionellosis
fca05145  Toxoplasmosis
fca05152  Tuberculosis
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05162  Measles
fca05163  Human cytomegalovirus infection
fca05164  Influenza A
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05200  Pathways in cancer
fca05210  Colorectal cancer
fca05222  Small cell lung cancer
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101098213
   04215 Apoptosis - multiple species
    101098213
   04115 p53 signaling pathway
    101098213
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101098213
  09162 Cancer: specific types
   05210 Colorectal cancer
    101098213
   05222 Small cell lung cancer
    101098213
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101098213
   05012 Parkinson disease
    101098213
   05014 Amyotrophic lateral sclerosis (ALS)
    101098213
   05016 Huntington disease
    101098213
  09166 Cardiovascular disease
   05416 Viral myocarditis
    101098213
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101098213
  09171 Infectious disease: bacterial
   05134 Legionellosis
    101098213
   05152 Tuberculosis
    101098213
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101098213
   05162 Measles
    101098213
   05164 Influenza A
    101098213
   05161 Hepatitis B
    101098213
   05160 Hepatitis C
    101098213
   05168 Herpes simplex virus 1 infection
    101098213
   05163 Human cytomegalovirus infection
    101098213
   05167 Kaposi sarcoma-associated herpesvirus infection
    101098213
   05169 Epstein-Barr virus infection
    101098213
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101098213
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    101098213
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-GeneID: 101098213
NCBI-ProteinID: XP_006929319
UniProt: M3X7H4
Position
A2
AA seq 105 aa AA seqDB search
MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTDANKNKGITW
GEETLMEYLENPKKYIPGTKMIFAGIKKAGERADLIAYLKKATKE
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgggtgatgttgagaagggcaagaagatttttgttcagaagtgtgcccagtgccatact
gtggaaaagggaggcaagcacaagactgggccaaatctccacggtttatttgggcgaaag
acaggccaagcccctgggttttcttacacggatgccaacaagaacaaaggcatcacctgg
ggagaggagacactgatggagtatttggagaatcccaagaagtacatccctggaacaaaa
atgatcttcgctggcattaagaaggcaggggaaagagcagacttgatagcttatctcaaa
aaagctactaaggagtaa

KEGG   Felis catus (domestic cat): 101100947Help
Entry
101100947         CDS       T02385                                 

Definition
(RefSeq) cytochrome c
  KO
K08738  cytochrome c
Organism
fca  Felis catus (domestic cat)
Pathway
fca01524  Platinum drug resistance
fca04115  p53 signaling pathway
fca04210  Apoptosis
fca04215  Apoptosis - multiple species
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05014  Amyotrophic lateral sclerosis (ALS)
fca05016  Huntington disease
fca05134  Legionellosis
fca05145  Toxoplasmosis
fca05152  Tuberculosis
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05162  Measles
fca05163  Human cytomegalovirus infection
fca05164  Influenza A
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05200  Pathways in cancer
fca05210  Colorectal cancer
fca05222  Small cell lung cancer
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101100947
   04215 Apoptosis - multiple species
    101100947
   04115 p53 signaling pathway
    101100947
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101100947
  09162 Cancer: specific types
   05210 Colorectal cancer
    101100947
   05222 Small cell lung cancer
    101100947
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101100947
   05012 Parkinson disease
    101100947
   05014 Amyotrophic lateral sclerosis (ALS)
    101100947
   05016 Huntington disease
    101100947
  09166 Cardiovascular disease
   05416 Viral myocarditis
    101100947
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101100947
  09171 Infectious disease: bacterial
   05134 Legionellosis
    101100947
   05152 Tuberculosis
    101100947
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101100947
   05162 Measles
    101100947
   05164 Influenza A
    101100947
   05161 Hepatitis B
    101100947
   05160 Hepatitis C
    101100947
   05168 Herpes simplex virus 1 infection
    101100947
   05163 Human cytomegalovirus infection
    101100947
   05167 Kaposi sarcoma-associated herpesvirus infection
    101100947
   05169 Epstein-Barr virus infection
    101100947
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101100947
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    101100947
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-GeneID: 101100947
NCBI-ProteinID: XP_011290006
UniProt: M3X7H4
Position
X
AA seq 105 aa AA seqDB search
MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTDANKNKGITW
GEETLMEYLENPKKYIPGTKMIFAGIKKAGERADLIAYLKKATKE
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgggtgatgttgagaagggcaagaagatttttgttcagaagtgtgcccagtgccatact
gtggaaaagggaggcaagcacaagactgggccaaatctccacggtttatttgggcgaaag
acaggccaagcccctgggttttcttacacggatgccaacaagaacaaaggcatcacctgg
ggagaggagacactgatggagtatttggagaatcccaagaagtacatccctggaacaaaa
atgatcttcgctggcattaagaaggcaggggaaagagcagacttgatagcttatctcaaa
aaagctactaaggagtaa

DBGET integrated database retrieval system