KEGG   Felis catus (domestic cat): 101088408Help
Entry
101088408         CDS       T02385                                 

Gene name
MYLK4
Definition
(RefSeq) myosin light chain kinase family member 4 isoform X1
  KO
K00907  myosin-light-chain kinase [EC:2.7.11.18]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04020  Calcium signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04270  Vascular smooth muscle contraction
fca04371  Apelin signaling pathway
fca04510  Focal adhesion
fca04611  Platelet activation
fca04810  Regulation of actin cytoskeleton
fca04921  Oxytocin signaling pathway
fca04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    101088408 (MYLK4)
   04020 Calcium signaling pathway
    101088408 (MYLK4)
   04022 cGMP-PKG signaling pathway
    101088408 (MYLK4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101088408 (MYLK4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101088408 (MYLK4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101088408 (MYLK4)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    101088408 (MYLK4)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101088408 (MYLK4)
  09154 Digestive system
   04971 Gastric acid secretion
    101088408 (MYLK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101088408 (MYLK4)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.18  myosin-light-chain kinase
     101088408 (MYLK4)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   101088408 (MYLK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like
Motif
Other DBs
NCBI-GeneID: 101088408
NCBI-ProteinID: XP_006931562
Position
B2
AA seq 685 aa AA seqDB search
MSSYKCQEEGTLKAHDCVLIYKSETEGDENHTPDSNLIGLTTKMLKVKRLEEINTCYNSN
KLEKMAFFHCMEKVEKVKCFLEESSSEQDSRSGKNEGKEKAQSHPGLKETAPVKGKRTLA
LTERSSQKNQLSSEKEKVNKLNKKNSEKTNASLAQRSFVTFHTERPQDEVEDFALRNSIE
SRENIDTRDISSTERLNRQEKISAGDDKQASVDKNELPVFKGEKNGLHSKEDTNEREVEK
KGGPAIANETVLDKCSNKKQYVDKTNGDQFYERCISNVKAISTSRILENSAIAPIFQNAE
QAEHIGSSKRRVTEECFIQEDNKKSRIDVASTGEGHAFRTQETRQAQGSLQGNPLESAGI
KTSRQQDLVTPLDDVPAPPAPFNHRIVTAKQAAVNSFYTVSRTEILGGGRFGQVHKCEEK
ATGLKLAAKIIKTRGTKDKDEVKNEINIMNQLDHVNLIQLYDAFESKNDIVLVMEYVDGG
ELFDRIIDDNYNLTEFDTILFIKQICEGIRHMHQMYILHLDLKPENILCVNRDAKQIKII
DFGLARRYKPREKLKVNFGTPEFLAPEVVNYDFVSFPTDMWSVGVIAYMLLSGLSPFLGD
NDAETLNNILACRWDLQDEEFQDISEEAREFISKLLIKEKSWRISASEALKHPWLSDHKL
HSRLISQVTKKKKNCCSNAKDLVTK
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcctataaatgtcaagaggaaggcactctcaaagctcatgattgcgtcttaatt
tacaaatcagagacagagggagatgaaaaccacactccagacagtaacttaatcggtctc
accaccaagatgttaaaagtgaagaggctggaagaaatcaacacatgttataacagtaac
aaactggagaaaatggcctttttccactgcatggaaaaggttgagaaagtgaaatgtttt
ctggaagaaagttctagtgaacaagattcaagatctggaaagaatgagggtaaggagaag
gcacagtcacaccctgggctgaaggaaacggcacctgtcaaaggcaaaaggacattggcc
ctcacagagagatcttcccagaagaaccagctctcctctgagaaggaaaaggttaataaa
ctcaacaagaaaaattctgagaagaccaatgcctctctagctcagagaagttttgtcaca
tttcatacagaaagacctcaagacgaggtagaagattttgccctaagaaattccatagag
tcaagagaaaatatagacacaagagacatttcaagcacagagagactgaacagacaagaa
aagattagtgctggagatgataaacaagcctctgtggataaaaatgaacttccagtgttc
aaaggagagaaaaatgggcttcattctaaggaagacactaatgaaagagaagttgagaaa
aaaggaggaccagcaattgcaaatgaaacagtgttggacaagtgttcaaataaaaagcag
tatgttgataaaactaatggtgatcaattctatgaaaggtgtatcagcaatgtaaaagcc
atttctacatcacgaatcctggaaaattcagcaatagcacccattttccagaatgctgag
caagcagagcatattggcagcagcaagcggcgggtgacggaggagtgcttcatccaagag
gacaacaaaaagagcagaatagatgtagcgagtacaggtgaaggacatgcatttaggaca
caggaaaccagacaagcccaggggagcttacaaggcaaccccctggaatctgctggaatt
aagacctccagacagcaagatctggtgaccccattggatgatgtcccagctcctcctgcc
ccctttaatcaccgtattgtgacagccaagcaagcagcagtcaacagtttttacactgtg
agcagaactgaaattttaggaggggggcgctttggccaggtacacaagtgtgaagagaaa
gcaacaggtctgaagctggcagctaagatcatcaagaccagaggcacaaaggataaggat
gaagtaaagaacgagatcaacatcatgaaccagctggatcatgtgaacctcattcagctc
tatgatgcctttgagtctaagaatgacattgtgctggtcatggagtacgtggatggaggg
gagctgtttgatcgcatcatcgatgacaactacaatctgaccgagtttgacaccatcctg
ttcatcaagcaaatatgtgagggcataagacacatgcatcagatgtacattctccatttg
gatctgaagcctgagaatatcctgtgtgtgaatcgggatgctaaacaaataaaaattatt
gattttggattggccagaagatacaaacccagagagaagctgaaggtgaattttggaacc
ccagaatttcttgctcctgaagttgtgaactatgattttgtttcctttcccactgacatg
tggagtgtgggcgtcattgcctatatgctactgagtggattgtcccccttcctgggtgac
aatgatgctgagaccctgaacaacatcctggcctgcaggtgggacttacaggatgaagaa
tttcaggacatctcagaggaagccagagagtttatctccaagcttctgattaaggagaag
agttggagaataagtgcaagtgaggctctcaagcacccctggctgtcagaccacaagctc
cactccagactcatttcacaggtaaccaagaagaagaagaattgctgctctaatgcgaag
gaccttgtgaccaaatag

KEGG   Felis catus (domestic cat): 101091744Help
Entry
101091744         CDS       T02385                                 

Gene name
MYLK3
Definition
(RefSeq) myosin light chain kinase 3 isoform X1
  KO
K00907  myosin-light-chain kinase [EC:2.7.11.18]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04020  Calcium signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04270  Vascular smooth muscle contraction
fca04371  Apelin signaling pathway
fca04510  Focal adhesion
fca04611  Platelet activation
fca04810  Regulation of actin cytoskeleton
fca04921  Oxytocin signaling pathway
fca04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    101091744 (MYLK3)
   04020 Calcium signaling pathway
    101091744 (MYLK3)
   04022 cGMP-PKG signaling pathway
    101091744 (MYLK3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101091744 (MYLK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101091744 (MYLK3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101091744 (MYLK3)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    101091744 (MYLK3)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101091744 (MYLK3)
  09154 Digestive system
   04971 Gastric acid secretion
    101091744 (MYLK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101091744 (MYLK3)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.18  myosin-light-chain kinase
     101091744 (MYLK3)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   101091744 (MYLK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo DUF1128 APH
Motif
Other DBs
NCBI-GeneID: 101091744
NCBI-ProteinID: XP_011288487
Ensembl: ENSFCAG00000001388
Position
E2
AA seq 800 aa AA seqDB search
MSEASKEGVETWGLLVSGKACLTTMDKKLNVLNEKVDKLLHFQEDVTEKLQCVYQGMGHL
EQGLHRLEASHILGPGGADHTPPADAQAGWPEVLELVRNVRQDAAQHGARLEALFRMVVA
VDKAIALVGAVFQNSKVMDFIMQGSVPWRKGSLADGSSENKDQVEEKGAKPKHVLSTRAV
QAEIRGSPEESQKENLPEGTVETLTPINASGIGSDLLTQEEASLGQAEVPPGHLPLPTEV
EAKVPRAFIENPGTDLELSAAPKRVKEAPTSQETLPSTARGSSFSRPDSRPTEAGMRLTP
GLPVQAKAAYSGVETPPRISIHVQETDTPGELLVTRGGSLRHIPPEEAPAAAYPGEQDPP
GPTPQTPVTKSEKQIPKGAGKISPLQKQSSDEGAKAEEKQGPGAESTVGPRGARRNMGDH
AGSLGRQQDKDPGTGHPEPGKDCTSRGMGRAEAGRKTPLGAEAGSVVLDDSPAPPAPFEH
RVVSVKETATSAVYTVCQHDVLGGGRFGQVHRCTEKSTGLSLAAKIIKVKSAKDREDVKN
EVYIMNQLSHVNLIQLYDAFESKNSFTLVMEYVDGGELFDRITEEKYQLTELDVILFTKQ
ICEGVHYLHQHYILHLDLKPENILCVNQTGHQIKIIDFGLARRYKPREKLKVNFGTPEFL
APEVVNYEFVSFPTDMWSVGVITYMLLSGLSPFLGETDAETMNFIVNCSWEFDADTFEGL
SEEAKDFVSRLLVKEKSCRMSATQCLKHEWLNNLPDKASKSKVCLKSQLLLQKYMAQRKW
KKHFYVVTAANRLRKFPTCP
NT seq 2403 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaagcctccaaggagggtgtggagacctgggggctgctggtgtcaggcaaggcc
tgcttaacaaccatggacaaaaagcttaatgtgctaaacgagaaggttgacaaactcttg
catttccaggaagatgtcacggagaaattgcagtgtgtgtaccaaggcatgggccacctg
gagcagggcctacaccgcctggaggcctctcacatcctgggcccaggtggggctgaccat
actcctccagctgacgcacaggctgggtggccagaggtcctggagctggtgaggaatgtg
cgtcaggatgctgcccagcatggtgccaggcttgaagccctattcaggatggtcgtggcc
gtggacaaggccatagctttggtgggggctgtgttccagaactcgaaggtgatggatttc
atcatgcaagggagtgtcccttggaggaaaggaagcctggctgatggctcttcagagaac
aaagatcaagtggaagagaaaggagcaaaaccaaagcatgtgctgagcaccagagccgtg
caggccgagatcagggggtctccggaggagagccagaaggaaaacttgccagaggggaca
gtggagacgctgactcccatcaatgcttcagggataggatctgatcttctcacccaggaa
gaggcttcactagggcaggcagaagtgccccctggccacctgccgctgcccacagaggtg
gaagccaaagttcctagagcattcattgagaaccctgggactgacctggaattgtctgca
gcacccaagagggtcaaggaggccccaaccagccaggagactttacccagtacagcacga
ggatcatcattcagcagacctgactctcggcccacagaggcaggcatgaggctgactcca
gggctgccagtccaggccaaggcagcttacagtggtgtagaaacacctccgaggatctcc
atccatgtgcaggaaacagacacccctggggagctgcttgtgacacgagggggcagcctc
agacacataccccctgaggaggctccagcagctgcctatccaggtgagcaggacccacct
gggcccaccccccagacccctgtgaccaagtcagaaaaacagatcccaaaaggagctgga
aagatttccccactgcagaagcagagcagcgatgagggagcaaaggcagaggagaagcag
gggcctggggctgagtccaccgtgggaccaagaggggccaggaggaacatgggagaccat
gctggatccctgggccggcagcaggacaaagacccagggacaggacaccctgagcctgga
aaggactgcacatccagaggcatgggcagagctgaagcaggaaggaagacccccctggga
gccgaggctggcagtgtggttctggatgacagtccagccccaccagccccttttgaacac
cgcgtggtgagtgtcaaggagaccgcgacctcagcagtttacacagtgtgccagcatgac
gtcttgggagggggccggtttggccaggtccacaggtgcacagagaagtccacaggcctc
tcactggcagctaagatcatcaaagtgaagagtgccaaggaccgggaggatgtgaagaat
gaggtctacatcatgaaccagctcagccacgtgaacctgatccagctctatgatgccttt
gaaagcaagaacagcttcaccctcgtcatggaatatgtggatggaggtgagctctttgac
cggatcacagaggagaagtaccagctgactgaactggatgtgatcttgttcaccaagcag
atctgcgagggtgtgcattacctccatcagcactatatcctgcacttggacctcaagcca
gagaacatactgtgtgtcaatcagacaggacatcaaattaagatcattgactttgggctg
gccagaaggtacaagcctcgggagaagcttaaggtgaacttcggcactccagagttcctg
gccccagaagtcgtcaactatgaatttgtgtccttccctacagacatgtggagtgtgggg
gtcattacctacatgctactcagtggtttatccccatttctaggggaaacagatgcagag
accatgaatttcattgtgaactgtagctgggagtttgacgctgacacctttgaagggctg
tcagaagaggccaaggactttgtttcccgcctgctggtcaaagagaagagttgcagaatg
agtgccacgcagtgcctgaaacatgagtggttgaataatttgcctgacaaagcttcaaaa
tccaaagtttgtctcaaatcccaattattactgcagaaatacatggctcaaaggaaatgg
aagaaacatttctacgtggtgactgctgccaacaggctaaggaaatttccaacttgtccc
taa

KEGG   Felis catus (domestic cat): 101095813Help
Entry
101095813         CDS       T02385                                 

Gene name
MYLK2
Definition
(RefSeq) myosin light chain kinase 2, skeletal/cardiac muscle
  KO
K00907  myosin-light-chain kinase [EC:2.7.11.18]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04020  Calcium signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04270  Vascular smooth muscle contraction
fca04371  Apelin signaling pathway
fca04510  Focal adhesion
fca04611  Platelet activation
fca04810  Regulation of actin cytoskeleton
fca04921  Oxytocin signaling pathway
fca04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    101095813 (MYLK2)
   04020 Calcium signaling pathway
    101095813 (MYLK2)
   04022 cGMP-PKG signaling pathway
    101095813 (MYLK2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101095813 (MYLK2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101095813 (MYLK2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101095813 (MYLK2)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    101095813 (MYLK2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101095813 (MYLK2)
  09154 Digestive system
   04971 Gastric acid secretion
    101095813 (MYLK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101095813 (MYLK2)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.18  myosin-light-chain kinase
     101095813 (MYLK2)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   101095813 (MYLK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH Kinase-like
Motif
Other DBs
NCBI-GeneID: 101095813
NCBI-ProteinID: XP_006929922
Ensembl: ENSFCAG00000001899
Position
A3
AA seq 633 aa AA seqDB search
MATANGAVELGIQSPSTDKAPKGTAGEGPPATEKEPGPPDPKKGPGPPDGKKEPGPSNPK
EETGPPDAQKKPGPPDPKKEPVPPTLKKDAKADALEKGDGSPAQPSTSSQGPEGEGDLGG
GPAEGSAGQAAALPQQTATAEATVKKPKAKQETSGSQGPGEPKVHKKAAEGQAGARRGSP
AFLHSPSCPAIISRPEKLPAEKPPNEASELIFEGVPVTPGPADPGPATVAEGGKDIPAGS
QKEAGEKAPGQDGQAKVQGDTSRGIEFQAVPSEKSEVGQALGPTAKEEDCFQILDDCPPP
PAPFPHRIVELRPGNIHSQFSLNSKEALGGGKFGAVCTCTEKATGLKLAAKVIKKQTPKD
KEMVMLEIEVMNQLNHRNLIQLYAAIETSHEIVLFMEYIEGGELFERIVDEDYQLTEVDT
MVFVRQICDGILFMHKMRVLHLDLKPENILCVNTTGHLVKIIDFGLARRYNPNEKLKVNF
GTPEFLSPEVVNYDQISDKTDMWSMGVITYMLLSGLSPFLGDDDTETLNNVLSANWYFDE
ETFEAVSDEAKDFVSNLIVKDQRARMSAAQCLAHPWLNNLAEKAKRCNRRLKSQILLKKY
LMKRRWKKNFIAVSAANRFKKISSSGALMALGV
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atggcgacagcaaacggagcagtcgagctgggaatccagagcccatcgacagacaaggca
cctaaaggtacagcaggtgagggacccccggctacggagaaagagcctggtccaccagat
ccaaagaaaggtcctgggccgccagatgggaagaaagaacctggcccctcaaacccaaag
gaagaaaccggtcccccggatgcacagaaaaaacctgggcccccagacccaaagaaagaa
cctgttccacccaccctgaagaaagacgccaaagccgatgccctagagaaaggggacggg
tccccggcccaaccctcaacgagcagccagggccccgagggagaaggcgacctgggtggg
ggccccgcggagggcagcgctgggcaggcagcagccctgccccagcagacagcgacagcg
gaggccactgtcaagaagcccaaggccaagcaggagacctcaggcagccagggccccgga
gagcccaaggtacacaagaaggcagccgagggccaagcaggggccaggaggggctctccc
gcctttctgcacagcccgagctgtcctgccatcatctccaggcccgagaagctgccagct
gagaaacccccaaatgaggcatcagagctcatctttgaaggggtgcctgtgacccccggc
cccgcggatcccgggccagccacggtggcagaaggagggaaggacatcccagcaggcagc
cagaaggaagcaggagagaaggctccaggccaggatggccaggctaaggtgcaaggggac
acctcaagggggatcgagttccaggctgttccctcggagaaatcggaggtggggcaggcc
cttggtcccacagccaaggaagaggactgcttccagattttggatgactgtccgccaccc
ccagccccctttccccaccgcatcgtggagctgaggcctgggaacatccacagtcaattc
agcctgaactccaaggaggcgctgggcggcggcaagtttggagcagtctgtacctgcacg
gagaaagccacgggcctcaagctggcagccaaggtcatcaagaaacagacgcccaaagac
aaggaaatggtgatgcttgagatcgaggttatgaaccagctgaatcaccgcaacctgatc
cagctctacgcggccattgagacctcgcacgagatcgtcctgttcatggagtacatcgag
ggcggcgagctcttcgagaggattgtggatgaggactatcagctgactgaggtggacacc
atggtgtttgtcaggcagatctgtgatgggatcctcttcatgcacaagatgcgggttctg
cacctggacctcaagccagagaacatcctgtgtgtcaacaccacgggccatttggtgaag
atcattgactttggcctggcacggaggtataatcccaacgagaagctgaaggtgaatttt
gggaccccagagtttctgtcacctgaggtggtgaattatgaccaaatctccgataagaca
gacatgtggagtatgggggtcatcacctatatgctgctgagtggcctctcccccttcctg
ggagacgatgacacagagaccctaaacaacgttctctctgccaactggtactttgacgag
gagacctttgaggccgtgtctgatgaggccaaagacttcgtctccaacctcattgtcaag
gaccagagggcccggatgagcgctgcccagtgcctcgcccacccctggctcaacaacctg
gcagagaaagccaagcgctgtaaccgccgcctcaagtcccagatcttgcttaagaaatac
ctcatgaagaggcgctggaagaaaaacttcattgccgtcagtgctgcaaaccgcttcaag
aagatcagcagctcgggggcactcatggctctgggggtctga

KEGG   Felis catus (domestic cat): 494213Help
Entry
494213            CDS       T02385                                 

Gene name
MYLK
Definition
(RefSeq) myosin light chain kinase, smooth muscle
  KO
K00907  myosin-light-chain kinase [EC:2.7.11.18]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04020  Calcium signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04270  Vascular smooth muscle contraction
fca04371  Apelin signaling pathway
fca04510  Focal adhesion
fca04611  Platelet activation
fca04810  Regulation of actin cytoskeleton
fca04921  Oxytocin signaling pathway
fca04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    494213 (MYLK)
   04020 Calcium signaling pathway
    494213 (MYLK)
   04022 cGMP-PKG signaling pathway
    494213 (MYLK)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    494213 (MYLK)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    494213 (MYLK)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    494213 (MYLK)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    494213 (MYLK)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    494213 (MYLK)
  09154 Digestive system
   04971 Gastric acid secretion
    494213 (MYLK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    494213 (MYLK)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.18  myosin-light-chain kinase
     494213 (MYLK)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   494213 (MYLK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set Ig_3 ig Ig_2 V-set
Motif
Other DBs
NCBI-GeneID: 494213
NCBI-ProteinID: NP_001009384
Ensembl: ENSFCAG00000023052
UniProt: Q5MFQ7
Position
C2
AA seq 156 aa AA seqDB search
MAMISGLSGRKSSTGSPTSPLNAEKLESEEDVSQAFLEAVAEEKPHVKPYFSKTIRDLEV
VEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCGDDDAKY
TCKAVNSLGEATCTAELIVETMEEGEGEGEEEEEEE
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atggcaatgatctcagggctcagtggcaggaaatcctcaacaggatcaccaaccagcccg
ctcaatgcagaaaaattagaatctgaagaagatgtgtcccaagctttccttgaggctgtt
gctgaggaaaagccccatgtaaaaccctatttctctaagaccatccgtgatttagaagtt
gtggagggaagcgctgctaggtttgactgcaagattgaaggatacccagaccctgaagtt
gtctggttcaaagatgaccagtcaatccgggagtcccgccacttccagatagactacgac
gaggatgggaactgctctttaatcattagtgatgtttgcggggatgacgatgccaagtat
acctgcaaggctgtcaacagtctcggagaagccacctgcacagcagagctcattgtggaa
accatggaggaaggggaaggggaaggagaagaggaagaagaggaagagtga

DBGET integrated database retrieval system