KEGG   Felis catus (domestic cat): 101088456Help
Entry
101088456         CDS       T02385                                 

Gene name
RGS2
Definition
(RefSeq) regulator of G-protein signaling 2
  KO
K18154  regulator of G-protein signaling 2
Organism
fca  Felis catus (domestic cat)
Pathway
fca04022  cGMP-PKG signaling pathway
fca04740  Olfactory transduction
fca04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    101088456 (RGS2)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    101088456 (RGS2)
  09157 Sensory system
   04740 Olfactory transduction
    101088456 (RGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RGS COMPASS-Shg1
Motif
Other DBs
NCBI-GeneID: 101088456
NCBI-ProteinID: XP_003999540
Ensembl: ENSFCAG00000021989
UniProt: M3X7Y3
Position
F1
AA seq 211 aa AA seqDB search
MQSAMFLAVQHDCGSMDKSAGNSPKSEEKRGKMKRTLLKDWKTRLSYFLQNSSSPGKPKN
GKKSKQQTFIKPSPEEAQLWSEAFDELLASKYGLAAFRAFLKSEFCEENIEFWLACEDFK
KTKSPQKLSSKARKIYTDFIEKEAPKEINIDFQTKTLIAQNIQEATSGCFTTAQKRVYSL
MENNSYPRFLESEFYQDLCKKPQITTESHAT
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagtgccatgttcctggctgtccagcacgactgcggatccatggacaagagcgca
ggcaacagccccaagagcgaggagaagaggggaaaaatgaagcggaccctattaaaagat
tggaagacccgtttgagctacttcttgcaaaactcatcctctcctgggaagcccaaaaat
ggcaagaaaagcaaacagcaaaccttcatcaagccttcccctgaggaagcacaactgtgg
tcggaagcatttgacgagctgctagccagtaaatatggtcttgctgcattcagggctttt
ttaaaatctgaattttgtgaagaaaatattgaattctggctggcctgtgaagacttcaaa
aaaaccaagtcaccccaaaagctgtcctcaaaagcaagaaaaatatatactgatttcata
gaaaaagaagctccaaaagagataaacatagactttcaaaccaaaactctgattgcccaa
aatatacaagaggctacaagtggctgctttacaactgcccagaaaagggtctacagcttg
atggagaacaactcttatcctcgtttcttggagtcggaattctaccaggacttgtgtaaa
aagccacagatcaccacagagtcccatgctacatga

DBGET integrated database retrieval system