KEGG   Felis catus (domestic cat): 101088592Help
Entry
101088592         CDS       T02385                                 

Gene name
ALDH1L2
Definition
(RefSeq) mitochondrial 10-formyltetrahydrofolate dehydrogenase isoform X1
  KO
K00289  formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00670  One carbon pool by folate
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    101088592 (ALDH1L2)
Enzymes [BR:fca01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.6  formyltetrahydrofolate dehydrogenase
     101088592 (ALDH1L2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh Formyl_trans_N Formyl_trans_C PP-binding DUF1487
Motif
Other DBs
NCBI-GeneID: 101088592
NCBI-ProteinID: XP_023113157
Ensembl: ENSFCAG00000001459
Position
B4
AA seq 923 aa AA seqDB search
MLWLGSQALRRFSTGRAHFKNKLKLALIGQSLFGQEVYSHLRKEGHRVVGVFTVPDKDGK
TDPLALAAEKDGTPVFKFPRWRVKGKTIKEVAEAYKSVGAELNVLPFCTQFIPMDVIDSP
KYGSIIYHPSILPRHRGASAINWTLIMGDKKAGFSVFWADDGLDTGPILLQKSCDVEPND
TVDALYNRFLFPEGIKAMVEAVQLIADGKAPRIPQPEEGATYEGIQKKENAEISWDQSAE
VLHNWIRGHDKVPGAWTEINGQMVTFYGSSLLKSSVPSGEPLEIKGATKPGLVTKNGLVL
FGNDGKALMVRNLQFEDGRMIPASQYFSAGETSVLELTAEEVKVAGTIKVIWAGILSNVP
VIEDSTDFFKSGASSMDVVRLVEEIRQKCGGLQLQNEDVYLATKFEDFIQKVVRKLRGEE
SEEELVVDYVSKEVNEMTVKMPYQCFINGQFTDADDGKTYDTINPTDGSIICKVSYASLV
DVDKAVAAAKDAFENGEWGRMNARERGRLMYRLADLLEENQEELATIEALDSGAVYTLAL
KTHIGMSVQTFRYFAGWCDKIQGSTIPINQARPNRNLTFTKKEPLGVCAIIIPWNYPLMM
LAWKSAACLAAGNTLVLKPAQVTPLTALKFAELSVKAGFPKGVINIIPGSGGIAGQRLSE
HPDIRKLGFTGSTAIGKQIMKSCAVSNLKKVSLELGGKSPLIIFNDCELDKAVRMGMGAV
FFNKGENCIAAGRLFVEEAIHDEFVTRVVEEIKKMKIGDPLDRSTDHGPQNHKAHLEKLL
QYCEAGVKEGATLVYGGRQVQRPGFFMEPTVFTDVEDHMYLAKEESFGPIMVISKFQNGD
IDGVLQRANNTEYGLASGVFTRDINKAMYVSEKLEAGTVFVNTYNKTDVAAPFGGVKQSG
FGKDLGEEALNEYLKTKTVTLEY
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atgctgtggctgggcagccaggcgctccggcgcttctccaccggccgggcccatttcaaa
aacaagctgaagctggcacttattggtcagagccttttcggacaggaagtgtacagtcac
ctccgcaaagagggccaccgagttgtgggcgtgttcacggttccagacaaggatggcaaa
actgacccgctggctttagctgcagagaaagatgggacccccgtgttcaagttccccaga
tggagagtcaagggcaagaccataaaggaggtggcagaggcctacaaatctgtgggtgct
gagctaaacgtgcttcccttctgcacacagtttatccccatggatgtaattgacagccca
aagtacggctccatcatatatcacccctccatccttcccaggcatagaggagcctctgct
atcaactggactctaattatgggagataagaaagctgggttttctgttttctgggctgat
gatggtttagacacaggacccatccttcttcagaagtcatgtgatgttgaacccaatgat
acagtggatgcactttataatcggtttctctttcctgaaggaatcaaagccatggtggaa
gctgttcaactcatagccgatggaaaagctcctcgcattccccaaccagaagaaggagca
acatatgaaggcatccagaaaaaggaaaatgctgagatttcttgggatcagtctgccgaa
gttttgcataactggatccgaggtcatgataaagtccctggagcttggacagagataaat
ggacagatggtcacgttttatggctcgtcattgctgaaaagctccgtgccttctggagaa
ccactggaaatcaaaggtgccacgaagcctggtcttgttaccaaaaatggacttgttctt
tttggtaatgatggaaaagcactgatggtgaggaatttgcagtttgaagatggaagaatg
attccagcctctcagtacttttcagcgggtgagacctcagtgctagaacttacagccgaa
gaggtgaaggtggcagggaccatcaaggtcatctgggctggaattttaagtaacgtccct
gttattgaagactcgacagacttctttaaatctggagcaagctcaatggatgttgtcagg
ctggttgaagagatcagacagaagtgcggtgggcttcaactacagaatgaagatgtctat
ctggccaccaagtttgaagacttcattcagaaagttgtgaggaaactgagaggagaagaa
tcggaagaggagctggtggtggattatgtttcaaaggaggtcaatgaaatgacagtgaaa
atgccatatcagtgtttcataaatggacagttcacagatgctgatgatggaaagacctat
gatactatcaacccaacagacggatctataatatgcaaagtatcctatgcttctttggtg
gatgttgataaagcagtagcagcagcaaaagatgcctttgaaaacggtgaatggggaaga
atgaatgcaagagaaagaggaaggttgatgtacagacttgcagacctactggaagagaac
caggaggagctggcaaccattgaagcccttgattcaggggctgtctacaccctggctctg
aagactcacatcggaatgtctgtgcaaacattcagatattttgctggctggtgtgacaaa
attcagggttctactattccaatcaaccaggcccgtccaaatcgcaatctgaccttcacc
aagaaggagccgcttggggtctgcgccattatcatcccctggaattacccactgatgatg
ctggcgtggaaaagcgccgcgtgtctggccgcgggtaacaccctagtgctcaagccagcg
caggtcacgcccttgactgctttgaagtttgctgagctctccgtgaaagcaggctttccc
aagggggtaatcaacatcatcccaggctcaggtggcatagctgggcaacgcctttctgaa
catcctgatatccgtaaacttggtttcactgggtccactgctattggcaaacagatcatg
aagagctgtgctgtgagcaacctgaagaaagtttcccttgaacttggtggcaaatcccca
cttataatattcaatgactgtgaacttgacaaggccgtgagaatgggcatgggggcagta
tttttcaacaaaggagagaactgtattgcagccgggcgcttgtttgtggaagaagccatc
cacgatgaatttgtgacaagagtggtggaagaaattaaaaagatgaaaattggtgatcca
cttgacagatctaccgatcacgggccccaaaatcataaggcccatctggaaaagcttctg
caatactgtgaagctggagtgaaagagggggccaccttggtgtacgggggaagacaagtt
caaaggccaggcttttttatggaaccaactgtgttcacagatgtggaagaccacatgtat
cttgccaaagaggaatcatttgggcccataatggtcatttctaagttccaaaatggggac
atcgatggagtgttgcagcgagcaaataacacagagtacggtttggcctcaggggttttt
acaagagacataaataaagccatgtacgtgagcgagaaactagaagcgggaactgttttt
gttaacacctacaacaagacggacgtggccgcccctttcggtggggttaaacaatctggc
tttgggaaagacttaggtgaggaagctctaaacgaatacctcaaaaccaagactgtgacg
ctggaatactag

DBGET integrated database retrieval system