KEGG   Felis catus (domestic cat): 101088599Help
Entry
101088599         CDS       T02385                                 

Gene name
PLK3
Definition
(RefSeq) serine/threonine-protein kinase PLK3
  KO
K08862  polo-like kinase 3 [EC:2.7.11.21]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04068  FoxO signaling pathway
fca04625  C-type lectin receptor signaling pathway
fca05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    101088599 (PLK3)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101088599 (PLK3)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101088599 (PLK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101088599 (PLK3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:fca03036]
    101088599 (PLK3)
   03400 DNA repair and recombination proteins [BR:fca03400]
    101088599 (PLK3)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     101088599 (PLK3)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   101088599 (PLK3)
Chromosome and associated proteins [BR:fca03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   Polo kinases
    101088599 (PLK3)
DNA repair and recombination proteins [BR:fca03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    101088599 (PLK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr POLO_box Kinase-like Pkinase_fungal APH
Motif
Other DBs
NCBI-GeneID: 101088599
NCBI-ProteinID: XP_003990073
Ensembl: ENSFCAG00000009969
Position
C1
AA seq 646 aa AA seqDB search
MEPAAGFLSPRPFPRAAAPPAPPAGPGPPENASPGPDLEMLAGPPAPDSGRLITDPRSGR
TYFKGRLLGKGGFARCYEATDTETGNAYAVKVISQSRITKPHQREKILNEIELHRGLQHR
HIVRFSHHFEDADNIYIFLELCSRKSLAHIWKARHTLLEPEVRYYLRQILSGLKYLHQRG
ILHRDLKLGNFFITENMELKMGDFGLATRLEPPEHRKKTICGTPNYVAPEVLQRQGHGPE
ADVWSLGCVMYTLLCGSPPFETVDLKETYRCIKQVHYTLPASLSLPARQLLAAILRASPQ
DRPSIDQILRHDFFTKGYTPDRLPVSSCVTVPDLIPLNPARILFVKVTKSLFGRKKKSKN
HPEERDEVSCLVNGLTRTSIGHQDARPEAPAASGPAPLSLVETAPEDSSPRGTLASSGDG
FEEGLTVATVVESALCALRNCLAFMPPAEQNPAPLAQPEPLVWVSKWVDYSNKFGFGYQL
SSRRVAVLFNNGTHMALSANRKTVHYNPTSTKHFSFSVGAVPRALQPQLGVLRYFASYME
QRLMKGGDLPSVEEVEMPVPPLLLQWVKTDQALLMLFSDGTVQVNFYGDHTKLILSGWEP
LLVTFVARNRSACTYLASHLRQLGCSPDLRQRLRYALRLLRDRCPA
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atggagcccgccgccggcttcctatccccgcgtcccttcccgcgtgctgccgccccgccc
gcgccccctgccgggcccgggccgcctgagaatgcctcgccgggacctgatctggagatg
ctggccggaccaccggcgccggactcagggcgcctcatcaccgacccgcgcagcggccgc
acctacttcaaaggccgcctgttgggcaaggggggctttgcccgctgctacgaggccact
gacacggagaccggcaacgcctacgctgtcaaagtcatctcacagagccgcatcaccaag
ccgcatcaacgcgagaagatcctaaatgagattgagctgcaccgcggcctgcagcaccgc
cacatcgtgcgtttctcacaccactttgaggatgctgacaacatatacattttcctggag
ctctgcagccgaaagtccctggcccacatctggaaggcccggcacaccctgttggagcca
gaggtgcgctactacctgcgccagatcctttccggactcaagtacttgcaccagcggggc
atcctgcatcgagacctcaagctgggaaatttttttatcactgagaacatggaactgaag
atgggggactttgggttggcaacccggttggaacccccggaacataggaagaaaaccatc
tgtggcacccccaattatgtggctccagaagtgctgcaaagacagggccatggccccgag
gcagacgtgtggtccctgggctgtgttatgtacacactgctgtgtgggagtccccccttt
gagacagttgacttgaaggagacctatcgctgcatcaaacaggttcactacacactgcct
gccagcctctcactgcctgcccggcagctcctggctgccatccttcgagcctcgccccaa
gaccgcccctcaattgaccagatcctgcgccatgacttctttaccaagggctacaccccc
gaccggctccctgtcagcagctgtgtgacagtcccagacctgataccccttaacccagct
aggattctgtttgtcaaagttaccaagagcctctttggcaggaagaagaagagtaagaac
catcctgaggagcgggacgaggtctcctgtttggtgaatggcctcactcggacgtccatt
ggccatcaagatgccaggcctgaggctccagcagcttctggtccagcacccctcagcttg
gtagagacggcacctgaggacagctcaccccgtgggacactggcaagcagtggagatggg
tttgaagaaggtctgactgtggccacagtggtggagtcagccctctgtgctctgagaaac
tgcctggccttcatgcccccagcggaacagaacccagctccccttgcacagccagagcct
ctggtatgggtcagcaagtgggttgactactccaacaaatttggctttgggtatcaactg
tccagccgccgtgtggctgtgcttttcaacaatggcacacatatggccctttcagccaac
agaaagactgtgcactacaaccctaccagcacaaaacacttctctttctctgtgggtgct
gtgcctcgggccctgcagcctcagcttggtgtcctacgatattttgcctcctacatggag
cagcgtctcatgaagggtggtgatctgcccagtgtggaagaagtggagatgcctgtcccc
ccactcttgctgcagtgggtcaagactgatcaggccctactcatgctgtttagtgatggt
actgtccaggtgaacttctatggcgaccacaccaaactgatcctcagtggctgggagccc
ctgcttgtgacttttgtggcccgcaatcgcagtgcttgcacttacctcgcttcccacctt
cggcagctgggctgttctccggacctgcggcagcggctccgctatgctctgcgtctgctc
cgggaccgctgcccagcctag

DBGET integrated database retrieval system