KEGG   Felis catus (domestic cat): 101088746Help
Entry
101088746         CDS       T02385                                 

Definition
(RefSeq) histone H2B type 1
  KO
K11252  histone H2B
Organism
fca  Felis catus (domestic cat)
Pathway
fca05034  Alcoholism
fca05203  Viral carcinogenesis
fca05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:fca00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    101088746
  Immune diseases
   05322 Systemic lupus erythematosus
    101088746
  Substance dependence
   05034 Alcoholism
    101088746
Chromosome and associated proteins [BR:fca03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    101088746
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101088746
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like
Motif
Other DBs
NCBI-GeneID: 101088746
NCBI-ProteinID: XP_003985756
Ensembl: ENSFCAG00000023027
UniProt: M3X6T1
Position
B2
AA seq 126 aa AA seqDB search
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagccagccaagtccgctcccgccccgaagaagggctcaaagaaggcggtgacc
aaggcgcagaagaaggacggcaagaaacgcaagcgcagccgcaaggagagctactcggtg
tacgtgtacaaggtgctgaagcaggtgcaccccgacaccggcatctcgtccaaggccatg
ggcatcatgaactcgttcgtcaacgacatcttcgagcgcatcgcgggcgaggcgtcgcgc
ctggcgcattacaacaagcgctcgaccatcacgtcccgggagatccagacggccgtgcgc
ctgctgctgcccggggagctggccaagcacgccgtgtccgagggcaccaaggccgtcacc
aagtacaccagctccaagtag

DBGET integrated database retrieval system