KEGG   Felis catus (domestic cat): 101088764Help
Entry
101088764         CDS       T02385                                 

Gene name
EEA1
Definition
(RefSeq) early endosome antigen 1 isoform X1
  KO
K12478  early endosome antigen 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04144  Endocytosis
fca04145  Phagosome
fca05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    101088764 (EEA1)
   04145 Phagosome
    101088764 (EEA1)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    101088764 (EEA1)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101088764 (EEA1)
 Protein recycling
   Others
    101088764 (EEA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FYVE Atg14 IncA zf-Di19 zf-C2H2_9 zf-C2H2_4 Spc7
Motif
Other DBs
NCBI-GeneID: 101088764
NCBI-ProteinID: XP_023113063
Ensembl: ENSFCAG00000022916
Position
B4
AA seq 1457 aa AA seqDB search
MFRRILQRTPGRVGSQGSDLDSSAAPINTVDVNNESSSEGFICPLCMKRCITASDLSEHY
QQVHAENETRGQELLNDSSVTGFICPQCMKSLGSADELFKHYEVVHDAGNDSSHGGEALA
LKRDDLTLLRQEVQDLQASLKEEKWYSEELKKELEKFQGLQQQESKPDGLVADSSAELQS
LEQQLEEAQTENFNIKQMKDLFEQKAAQLATEIADIKSKYDEERSLREAAEQKVTYLTEE
LNKETIIIQDLKTELLQRPGIEDVAVLKKELVQVQTLMDNMTLEREKESEKLKDECKKLQ
AEYANSEMLKLEATISQLRSELAKGPQEVAVYVQELQKLKSSLNELTQKNQNLTEKLRKK
ELECTQLEEKHNEECVSKKNIQASLHQKDLDCQQLQSRLSASETSLQRIQAELGEKGEAT
QKLKEELSEVEAKYQHLKAEFKQLQQQREEKEQHGLQLQSEINQLHSKLLETERQLGEAH
GRLKEQRQLSSEKLMDKEQQVADLQLKLSRLEEQLKEKVTNSTELQHQLDKTKQQHQEQQ
ALQQSTTAKLREAQNDLEQVLRQIGDKDQKIQNLEALLQKSKENISLLEKEREDLYAKIQ
AGEGETAVLNQLQEKNHTLQEQVTQLTEKLKNQSESHKQAQENLHDQVQEQKAHLRAAQD
RVLSLETSVNELNSQLNESKEKVSQLDIQIKAKTELLLSAEAAKTAQRADLQNHLDTAQN
ALQDKQQELNKITTQLDQVTAKLQDKQEHCSQLESHLKEYKEKHLSLEQKTEELEGQIKK
LEADTLEVKGNKEQALQDLQLQRQLNTDLELRATELSKQLEMEKEIVSSTKLELQKKSEA
LENIKQMLTKQEEEKKILEQEIENLSQDAKMQHKELNNKIQTAAAELQKSKMEKETLMTE
LSAAKENLSKVSDSLKNSKSEFEKENQKGKAAILDLEKTCKELKHQLQVQTENALKEQNE
LKKSLEKEKQTSHQLNLELSSMQGQVAQAQNTLKQKEKEEQQLQGNINELKQLTEQKKKQ
IEALQGEIKIAVSQKTELENKLQQQSTQAAQELEAEKEKMSVLQITYEKSQENLKQLQSD
FYGKESELLATRQDLKSVEEKLSLAQEDLISNRNQIGNQNKLIQELKSSTATLEQDLAKK
EQQLKEQCKTLQDIKKEKSLKEKELVNEKSKLAEIEEIKCRQEKEIAKLSEELKSHKQES
IKEVTNLKDAKQLLIQQKLELQGKVDSLKATLDQEKRNQQMLKEQVKKEEDELKKEFTEK
EAKLHSEIKEKEIGMKKHEENEAKLTMQITALNENLGTVKKEWQSSQRRVSELEKQTDDL
RGEIAVLEATVQNNQDERRALLERCLKGEGEIEKLQTKVLELQRKLDNTTAAVQELGREN
QSLQIKHTQALNRKWAEDNEVQNCMACGKGFSVTVRRHHCRQCGNIFCAECSAKNALTPS
SKKPVRVCDACFNDLQG
NT seq 4374 nt NT seq  +upstreamnt  +downstreamnt
atgtttaggaggattttgcagaggactcctgggagagttggctctcaaggttctgattta
gattcatcagctgctcctataaacacagtggatgtcaataatgaaagctcttcagagggt
ttcatctgtccattatgtatgaaaagatgtataactgctagtgatttgtcggagcattac
cagcaagtgcacgctgaaaatgaaacaagaggacaggaacttcttaatgactccagtgtt
actggtttcatatgtccccagtgtatgaaatcccttgggtctgctgatgaacttttcaaa
cactatgaggtagttcatgatgctggtaatgattcaagtcatggaggagaggctcttgct
ctgaagcgagatgatttaacactacttagacaagaggtccaagaccttcaggcttcacta
aaggaagaaaaatggtactcagaagaattaaagaaagaattagaaaaatttcaagggctg
cagcagcaagagtctaaacctgatggattggtggctgattcatcagcagaactacagtct
ttggaacaacaattagaagaagcccaaacagaaaattttaatattaagcaaatgaaagac
ttatttgaacagaaagcagcccaacttgccactgaaattgcagatataaagtcaaaatat
gatgaagaaaggagtcttcgagaagctgctgaacaaaaagtgacgtatctgacagaggaa
ttaaacaaagaaacaattataattcaagatctgaagactgaactgcttcagagacctggt
atagaagatgttgctgtgctaaagaaagaactggtccaagttcaaacactaatggacaac
atgacgttggagcgtgaaaaagaatctgaaaaactcaaagatgagtgtaaaaagttacaa
gcagaatatgctaactcagagatgcttaaacttgaggccacaataagccagctaaggagt
gaacttgccaaaggcccccaggaagttgctgtatatgtgcaggaactacaaaaacttaaa
agttcacttaatgaattaacacaaaaaaatcagaacttgactgaaaagcttcgaaagaaa
gaactggagtgtactcagttagaggagaaacataacgaagaatgtgtgagtaaaaagaat
atacaagcaagccttcatcaaaaagacctagattgtcagcagcttcagtcaagattatct
gcatctgaaacctccctgcagagaatacaggcagaactaggtgaaaagggggaagctacg
cagaagctcaaggaagaattatcagaagtagaggccaagtaccagcatcttaaggctgaa
tttaaacagctacaacaacagagagaagagaaagagcagcacgggttacaactccaaagt
gaaattaatcaattacatagcaaacttctggagacagagcgccaactaggtgaagctcat
ggtaggctgaaggaacagagacagctttcaagtgaaaagttgatggataaagaacaacaa
gtggctgatctacaactcaaactttctcgtttagaagaacagttgaaggaaaaagtaaca
aattccacagaattgcagcatcaattagataaaacgaagcaacaacatcaagaacaacaa
gcccttcagcaaagcactacagcaaaacttcgagaagctcagaatgatttagaacaagta
ctacgtcaaattggcgataaggaccagaagatccagaaccttgaagccttattacagaag
agtaaagaaaatatttccttactagaaaaagaaagagaagatctttatgcaaaaattcag
gctggtgaaggagagactgctgttctcaaccagttacaagaaaaaaaccataccttacag
gaacaagtaactcaactaacagagaagctgaagaatcagtcagaaagccataaacaagcc
caggagaatttgcatgaccaagtgcaagagcagaaggcacatcttagagctgcacaagac
cgtgtcctttccttagaaactagtgtcaatgaattaaatagtcaattaaatgagagcaag
gagaaggtctcccagcttgacatacagattaaagccaaaactgaattattgctatcagca
gaagcagcaaaaactgctcaaagagcagatcttcagaatcatttggacacagcccaaaat
gcattacaagataaacagcaggagttaaataagatcactactcagttggatcaagtcact
gcaaagttacaggataagcaagaacattgcagtcagttggaaagtcatcttaaagaatat
aaagagaaacacctttctttagaacaaaaaactgaagaattagaaggtcaaattaagaaa
ctagaagctgatactcttgaagttaaaggaaacaaggagcaagctttgcaggatctacaa
ctgcaaagacagctgaatacagatttagagcttagagccacagaattgagtaaacaactt
gaaatggagaaagaaatagtatccagtacaaagttggaactacagaaaaaatctgaagct
cttgaaaatattaagcaaatgcttaccaagcaagaggaagaaaaaaaaatccttgaacaa
gaaattgaaaatttaagtcaggatgcaaagatgcagcacaaggaattgaataacaaaatt
caaacagcagcagcagaactgcaaaaatcgaagatggagaaagaaactctaatgacagag
ctttctgcggccaaagagaatttatcaaaagtttctgattctttgaagaactccaaaagt
gaatttgaaaaggaaaaccagaaaggaaaagctgctatattagatttggaaaaaacttgc
aaagaattaaagcatcagcttcaagtacagacagaaaatgcacttaaggaacagaatgaa
ctgaaaaagtcacttgaaaaagagaagcaaacttctcatcagttgaacttggaactcagt
tcaatgcagggacaagtggcacaggcccagaatacgttaaaacaaaaagaaaaagaagaa
cagcaacttcaggggaacataaatgagctaaagcaattgactgaacagaagaaaaagcaa
attgaagcactccaaggagaaattaaaattgctgtttcacagaagacagagcttgagaat
aaattacagcagcagtcaacacaagcagcccaggaacttgaagcagagaaagagaaaatg
tcagtgttacaaattacctatgaaaaaagtcaggaaaatctaaaacagcttcaatctgat
ttctatgggaaggaatctgaacttcttgccacaaggcaagatcttaagtctgtagaagag
aagctttctctagcacaagaggacttgatttcaaacagaaatcaaattggaaaccaaaat
aaattaattcaggaactgaagagttccacggctacgttggagcaggatttagcaaagaaa
gagcaacagttgaaggagcagtgtaaaacgctacaagatattaaaaaagaaaagtcactg
aaagaaaaagaactagtaaatgaaaagtctaaattggcagagatagaggaaattaagtgt
agacaggaaaaagaaattgctaaattgagtgaagaactcaagtcccacaagcaagaaagc
ataaaggaggtaacaaatctcaaggatgccaaacagcttttgattcagcagaaactcgag
cttcaagggaaagtagattccctgaaggcaacccttgaccaggagaagagaaaccagcaa
atgctaaaagagcaggtgaaaaaggaagaagatgaactaaagaaagagtttactgagaag
gaggctaaactgcattccgagataaaagaaaaagaaataggaatgaagaagcatgaagaa
aatgaagctaaacttaccatgcagattacagcgttaaatgaaaacttgggcaccgtaaag
aaggagtggcagtctagtcaacgtagagtcagcgagctcgagaaacagacggacgactta
cggggtgaaattgcagtattagaagccacagttcagaataatcaggatgaaaggagagca
ctactagaaagatgtcttaaaggagaaggtgaaatagaaaagcttcaaaccaaagtacta
gaattgcaaagaaagctggataatacgaccgcagcggtgcaggagctgggcagagaaaat
caatcccttcaaatcaaacacacgcaagcgttaaataggaagtgggcggaagacaatgaa
gtacaaaactgcatggcctgtgggaaaggcttttcagtaacagtgagacggcatcactgc
agacaatgtggaaatatcttctgtgctgagtgttcggccaaaaatgccttaactccatct
tctaagaagcctgttcgtgtctgtgatgcatgtttcaatgacttgcaaggataa

DBGET integrated database retrieval system