KEGG   Felis catus (domestic cat): 101088847Help
Entry
101088847         CDS       T02385                                 

Gene name
SOS2
Definition
(RefSeq) LOW QUALITY PROTEIN: son of sevenless homolog 2
  KO
K03099  son of sevenless
Organism
fca  Felis catus (domestic cat)
Pathway
fca01521  EGFR tyrosine kinase inhibitor resistance
fca01522  Endocrine resistance
fca04010  MAPK signaling pathway
fca04012  ErbB signaling pathway
fca04014  Ras signaling pathway
fca04062  Chemokine signaling pathway
fca04068  FoxO signaling pathway
fca04072  Phospholipase D signaling pathway
fca04150  mTOR signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04510  Focal adhesion
fca04540  Gap junction
fca04630  Jak-STAT signaling pathway
fca04650  Natural killer cell mediated cytotoxicity
fca04660  T cell receptor signaling pathway
fca04662  B cell receptor signaling pathway
fca04664  Fc epsilon RI signaling pathway
fca04714  Thermogenesis
fca04722  Neurotrophin signaling pathway
fca04810  Regulation of actin cytoskeleton
fca04910  Insulin signaling pathway
fca04912  GnRH signaling pathway
fca04915  Estrogen signaling pathway
fca04917  Prolactin signaling pathway
fca04926  Relaxin signaling pathway
fca05034  Alcoholism
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05163  Human cytomegalovirus infection
fca05165  Human papillomavirus infection
fca05200  Pathways in cancer
fca05205  Proteoglycans in cancer
fca05206  MicroRNAs in cancer
fca05210  Colorectal cancer
fca05211  Renal cell carcinoma
fca05213  Endometrial cancer
fca05214  Glioma
fca05215  Prostate cancer
fca05220  Chronic myeloid leukemia
fca05221  Acute myeloid leukemia
fca05223  Non-small cell lung cancer
fca05224  Breast cancer
fca05225  Hepatocellular carcinoma
fca05226  Gastric cancer
fca05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101088847 (SOS2)
   04010 MAPK signaling pathway
    101088847 (SOS2)
   04012 ErbB signaling pathway
    101088847 (SOS2)
   04630 Jak-STAT signaling pathway
    101088847 (SOS2)
   04068 FoxO signaling pathway
    101088847 (SOS2)
   04072 Phospholipase D signaling pathway
    101088847 (SOS2)
   04151 PI3K-Akt signaling pathway
    101088847 (SOS2)
   04150 mTOR signaling pathway
    101088847 (SOS2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101088847 (SOS2)
   04540 Gap junction
    101088847 (SOS2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101088847 (SOS2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    101088847 (SOS2)
   04660 T cell receptor signaling pathway
    101088847 (SOS2)
   04662 B cell receptor signaling pathway
    101088847 (SOS2)
   04664 Fc epsilon RI signaling pathway
    101088847 (SOS2)
   04062 Chemokine signaling pathway
    101088847 (SOS2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101088847 (SOS2)
   04912 GnRH signaling pathway
    101088847 (SOS2)
   04915 Estrogen signaling pathway
    101088847 (SOS2)
   04917 Prolactin signaling pathway
    101088847 (SOS2)
   04926 Relaxin signaling pathway
    101088847 (SOS2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101088847 (SOS2)
  09159 Environmental adaptation
   04714 Thermogenesis
    101088847 (SOS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101088847 (SOS2)
   05206 MicroRNAs in cancer
    101088847 (SOS2)
   05205 Proteoglycans in cancer
    101088847 (SOS2)
   05231 Choline metabolism in cancer
    101088847 (SOS2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101088847 (SOS2)
   05225 Hepatocellular carcinoma
    101088847 (SOS2)
   05226 Gastric cancer
    101088847 (SOS2)
   05214 Glioma
    101088847 (SOS2)
   05221 Acute myeloid leukemia
    101088847 (SOS2)
   05220 Chronic myeloid leukemia
    101088847 (SOS2)
   05211 Renal cell carcinoma
    101088847 (SOS2)
   05215 Prostate cancer
    101088847 (SOS2)
   05213 Endometrial cancer
    101088847 (SOS2)
   05224 Breast cancer
    101088847 (SOS2)
   05223 Non-small cell lung cancer
    101088847 (SOS2)
  09165 Substance dependence
   05034 Alcoholism
    101088847 (SOS2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    101088847 (SOS2)
   05160 Hepatitis C
    101088847 (SOS2)
   05163 Human cytomegalovirus infection
    101088847 (SOS2)
   05165 Human papillomavirus infection
    101088847 (SOS2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101088847 (SOS2)
   01522 Endocrine resistance
    101088847 (SOS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RasGEF RasGEF_N RhoGEF Histone PH IQ_SEC7_PH PH_13
Motif
Other DBs
NCBI-GeneID: 101088847
NCBI-ProteinID: XP_023111443
Ensembl: ENSFCAG00000031655
Position
B3
AA seq 1332 aa AA seqDB search
MQQAPQPYEFFSEENSPKWRGLLVSALRKVQEQVHPNLSANEESLYYIEELIFQLLNKLC
MAQPRTVQDVEERVQKTFPHPIDKWAIADAQSAIEKRKRRNPLLLPVDKIHPSLKEVLGY
KVDYHVSLYIVAVLEYISADILKLAGNYVFNIRHYEISQQDIKVSMCADKVLMDMFDQDD
IGLVSLCEDEPSSSGELNYYDLVRTEIAEERQYLRELNMIIKVFREAFLSDRKLFKPCDI
ERIFSNISDIHELTVKLLGLIEDTVEMTDESSPHPLAGSCFEDLAEEQAFDPYETLSQDI
LSPKFNEHFSKLMARPAVALHFQSIADGFKEAVRYVLPRLMLVPVYHCWHYFELLKQLKA
CSEEQEDRECLNQAITALMNLQGSMDRIYKQYSPRRRPGDPICPFYNRHLRSKHLAIKKM
NEIQKNIDGWEGKDIGQCCNEFIMEGPLTRIGAKHERHIFLFDGLMISCKPNHSQSRLPG
YSSAEYRLKEKFVMRKIQICDKEDTCECKHAFEIVSKDENSIIFAAKSAEEKNNWMAALI
SLHYRSTLDRMLDSVLLKEENEQPLRLPSPEVYRFVVKDSEENIVFEDNLQSRSGIPIIK
GGTVVKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLLIERFEIPEPEPTEADKLA
VEKGEQPISADLKRFRKEYVQPVQLRILNVFRHWVEHHFYDFERDLELLERLESFISSVR
GKAMKKWVESIAKIIKRKKQAQANGISHNITFESPPPPIEWHISRPGQFETFDLMTLHPI
EIARQLTLLESDLYRKVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIVEA
ENFEERVAVLSRIIEILQVFQDLNNFNGVLEIVSAVNSVSVYRLDHTFEALQERKRRILD
EAVELSQDHFKKYLVKLKSINPPCVPFFGIYLTNILKTEEGNNDFLKKKGKDLINFSKRR
KVAEITGEIQQYQNQPYCLRIEPEMRRFFENLNPMGSASEKEFTDYLFNKSLEIEPRNCK
QPPRFPRKSTFSLKSPGIRPNTGRHGSTSGTLRGHPTPLEREPYKISFSRIAETDLESTV
SAPTSPNTPSTPPVSASSDLSVFLDVDLNSSCGSNSIFAPVLLPHSKSFFSSCGSLHKLN
EEPLIPPPLPPRKKFDHDASNSKGNTKSDDDPPAIPPRQPPPPKVKPRVPAPTGAFDGPL
HSPPPPPPRDPLPDTPPPVPLRPPEHFINCPFNLQPPPLGHLHRDPEWLRDVSTCPNSPN
TPPSTPSPRVPRRCYALSSSHNNLAHPQAPPVPPRQNSSPHLPKLPPKTYKRELSHPPSY
RLPLLENAETPQ
NT seq 3999 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaggcgccgcagccgtacgagttcttcagcgaagagaacagtccgaaatggcgg
ggactgctggtctcggccctgcggaaggttcaggagcaagtacatcccaatctctcagct
aatgaagagtctctctattatattgaagagctgatttttcagctgcttaataaattatgc
atggctcagccaaggactgttcaagatgtggaggaacgtgttcagaagacctttcctcat
ccaattgacaagtgggctattgctgatgcacaatctgccatagaaaaacgaaaacgaaga
aatcctctcttactgcctgtggacaaaatccatccttcattgaaggaggttttagggtac
aaagtggactatcatgtatccctgtatattgtggctgtactagagtatatctcagctgat
attttgaagttggctggtaattatgtttttaatatccgacattatgaaatatctcagcag
gacattaaagtgtcaatgtgtgcagataaggttttgatggacatgtttgatcaggatgac
ataggtttggtttctctctgtgaagatgaaccaagttcttcaggtgaattaaactattat
gaccttgtcagaactgaaattgcagaagaaaggcagtatctacgggaattaaatatgatt
ataaaagtgtttcgagaagctttcctttctgacaggaagctatttaaaccttgtgatatt
gaaaggattttcagtaacatttcagatatacatgaattgaccgtgaaacttctaggtctt
attgaagacacagttgaaatgactgatgaaagcagccctcatccattagctggcagctgt
tttgaagatttggcagaagagcaagcatttgatccttatgaaacattatcacaggatatt
ctgtctccaaaatttaatgaacatttcagtaagttgatggccagacctgcagtggctcta
cactttcagtccattgctgatggttttaaagaggcagttcgttatgtccttccacgcctt
atgctggtgcctgtatatcattgttggcactattttgaattattaaagcaattgaaagca
tgtagtgaagagcaggaagacagagaatgtttgaaccaagctattactgctcttatgaat
ctccaaggtagtatggaccgaatttacaagcagtattcacctagacgccgacctggggat
cctatttgccctttttataatcgtcacttaagaagcaagcatctggctattaaaaaaatg
aatgaaattcagaaaaacatagatggatgggaaggcaaagatattggacagtgttgtaat
gaattcattatggaaggtccattgacacgaattggtgctaaacatgaacggcatattttt
ctctttgatggcttaatgattagctgtaagcccaatcatagccagtcacgccttccaggt
tacagtagtgcagaatacagattaaaagaaaaatttgtcatgaggaaaatacaaatatgt
gataaagaagatacctgtgaatgtaaacatgcttttgaaatagtatccaaagatgaaaac
agcataatatttgctgctaagtctgctgaagagaaaaataattggatggccgcacttatt
tctcttcactatcgtagtacgctagatcgaatgctagattcagtgttattgaaagaagaa
aatgagcagccactgagattaccaagtcctgaagtgtatcgttttgtggtaaaagactct
gaggaaaacattgtttttgaagacaacttgcaaagtagaagtggaattcccatcattaaa
ggaggaactgtggtgaaattaattgaaaggttaacatatcatatgtatgcagatcccaat
tttgtccgtacttttcttactacataccgttcattttgtaaaccacaggaattactaagc
ttactgattgaacgatttgaaattccagagccagaacctactgaagcagataaattggca
gtagagaaaggcgaacagccaatcagtgcagaccttaaaaggtttcgcaaggaatatgtc
caaccagtacaacttaggatcttaaatgtgtttcggcactgggttgaacatcatttttat
gactttgaaagagatttggagttgcttgagagactagaatccttcatttcaagtgtaaga
gggaaagctatgaagaagtgggtagagtcaattgctaagatcatcaagaggaagaaacaa
gctcaggcaaatggaataagccataatattacctttgagagtccacctccaccaattgaa
tggcatattagcagaccaggacagtttgaaacatttgatcttatgacacttcatccaata
gaaattgcacgtcagctgacacttttggaatctgatctctacaggaaagtccagccttct
gaacttgtagggagtgtgtggaccaaagaagataaagaaataaattctccaaatttatta
aaaatgattcgccataccacaaatctcaccctctggtttgaaaagtgcattgtggaagca
gaaaattttgaggaacgggtggcagtactaagtagaattatagaaattctgcaagttttt
caagatttgaataatttcaatggtgtattggagatagtcagtgcagtaaattcagtgtca
gtgtacagactagaccatacttttgaggcattgcaggaaagaaaaaggagaattttggat
gaagctgtggaattaagtcaagatcactttaaaaaatacctagtaaaacttaagtcaatc
aatccaccttgtgtgcctttttttggaatatatttaacaaatattctgaaaactgaagaa
gggaataatgattttttaaaaaagaaagggaaagatttaatcaatttcagtaagaggagg
aaagtagctgaaattactggagaaattcagcagtatcagaatcaaccttactgtttacgg
atagaaccagaaatgaggagattctttgaaaaccttaaccccatgggaagtgcttctgaa
aaggagtttacagattatttgttcaataagtcactagaaattgaaccccgaaactgcaaa
cagccacctcgatttcctaggaaatcaactttctctttaaaatctcctggaataaggcct
aatacaggccgacatggctctacctcaggcactttacgaggtcatccaacaccattagaa
agagaaccatataagataagctttagtcggattgctgaaactgatcttgaatcaactgtg
tcagcaccaacctctccaaatacgccatctactccaccagtatctgcttcttcagacctt
agtgtgtttttagatgtggatctcaacagttcctgtggcagcaatagcatctttgctcca
gtcctcttgccacattcaaagtctttcttcagttcatgtggtagtttacataaactaaat
gaagagccactgattcctcctccacttcctcctcgaaaaaagtttgatcatgatgcttca
aattccaagggaaatacgaaatctgatgatgacccccctgctattccaccaagacaacct
cctcctccaaaggtaaaacccagagttcctgctcctactggtgcatttgacgggcctctg
catagtccacctccaccaccgccgagagatcctcttcctgatacccctccaccagttccc
cttcggcctccagaacactttataaactgtccatttaatcttcagccacctccactagga
catcttcacagagatccagagtggctcagagacgttagtacctgtccaaattcaccaaat
actcctcctagcacaccctctccaagagtaccacgtcgatgctatgcgctcagttccagt
cacaataaccttgctcatcctcaagctccccctgttccaccaaggcagaattcaagccct
cacctaccaaaactgccaccaaagacttataaacgggagctttcacaccccccatcgtac
agactgcctttgctagaaaatgcagaaactcctcaatga

KEGG   Felis catus (domestic cat): 101098862Help
Entry
101098862         CDS       T02385                                 

Gene name
SOS1
Definition
(RefSeq) son of sevenless homolog 1 isoform X1
  KO
K03099  son of sevenless
Organism
fca  Felis catus (domestic cat)
Pathway
fca01521  EGFR tyrosine kinase inhibitor resistance
fca01522  Endocrine resistance
fca04010  MAPK signaling pathway
fca04012  ErbB signaling pathway
fca04014  Ras signaling pathway
fca04062  Chemokine signaling pathway
fca04068  FoxO signaling pathway
fca04072  Phospholipase D signaling pathway
fca04150  mTOR signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04510  Focal adhesion
fca04540  Gap junction
fca04630  Jak-STAT signaling pathway
fca04650  Natural killer cell mediated cytotoxicity
fca04660  T cell receptor signaling pathway
fca04662  B cell receptor signaling pathway
fca04664  Fc epsilon RI signaling pathway
fca04714  Thermogenesis
fca04722  Neurotrophin signaling pathway
fca04810  Regulation of actin cytoskeleton
fca04910  Insulin signaling pathway
fca04912  GnRH signaling pathway
fca04915  Estrogen signaling pathway
fca04917  Prolactin signaling pathway
fca04926  Relaxin signaling pathway
fca05034  Alcoholism
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05163  Human cytomegalovirus infection
fca05165  Human papillomavirus infection
fca05200  Pathways in cancer
fca05205  Proteoglycans in cancer
fca05206  MicroRNAs in cancer
fca05210  Colorectal cancer
fca05211  Renal cell carcinoma
fca05213  Endometrial cancer
fca05214  Glioma
fca05215  Prostate cancer
fca05220  Chronic myeloid leukemia
fca05221  Acute myeloid leukemia
fca05223  Non-small cell lung cancer
fca05224  Breast cancer
fca05225  Hepatocellular carcinoma
fca05226  Gastric cancer
fca05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101098862 (SOS1)
   04010 MAPK signaling pathway
    101098862 (SOS1)
   04012 ErbB signaling pathway
    101098862 (SOS1)
   04630 Jak-STAT signaling pathway
    101098862 (SOS1)
   04068 FoxO signaling pathway
    101098862 (SOS1)
   04072 Phospholipase D signaling pathway
    101098862 (SOS1)
   04151 PI3K-Akt signaling pathway
    101098862 (SOS1)
   04150 mTOR signaling pathway
    101098862 (SOS1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101098862 (SOS1)
   04540 Gap junction
    101098862 (SOS1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101098862 (SOS1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    101098862 (SOS1)
   04660 T cell receptor signaling pathway
    101098862 (SOS1)
   04662 B cell receptor signaling pathway
    101098862 (SOS1)
   04664 Fc epsilon RI signaling pathway
    101098862 (SOS1)
   04062 Chemokine signaling pathway
    101098862 (SOS1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101098862 (SOS1)
   04912 GnRH signaling pathway
    101098862 (SOS1)
   04915 Estrogen signaling pathway
    101098862 (SOS1)
   04917 Prolactin signaling pathway
    101098862 (SOS1)
   04926 Relaxin signaling pathway
    101098862 (SOS1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101098862 (SOS1)
  09159 Environmental adaptation
   04714 Thermogenesis
    101098862 (SOS1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101098862 (SOS1)
   05206 MicroRNAs in cancer
    101098862 (SOS1)
   05205 Proteoglycans in cancer
    101098862 (SOS1)
   05231 Choline metabolism in cancer
    101098862 (SOS1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101098862 (SOS1)
   05225 Hepatocellular carcinoma
    101098862 (SOS1)
   05226 Gastric cancer
    101098862 (SOS1)
   05214 Glioma
    101098862 (SOS1)
   05221 Acute myeloid leukemia
    101098862 (SOS1)
   05220 Chronic myeloid leukemia
    101098862 (SOS1)
   05211 Renal cell carcinoma
    101098862 (SOS1)
   05215 Prostate cancer
    101098862 (SOS1)
   05213 Endometrial cancer
    101098862 (SOS1)
   05224 Breast cancer
    101098862 (SOS1)
   05223 Non-small cell lung cancer
    101098862 (SOS1)
  09165 Substance dependence
   05034 Alcoholism
    101098862 (SOS1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    101098862 (SOS1)
   05160 Hepatitis C
    101098862 (SOS1)
   05163 Human cytomegalovirus infection
    101098862 (SOS1)
   05165 Human papillomavirus infection
    101098862 (SOS1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101098862 (SOS1)
   01522 Endocrine resistance
    101098862 (SOS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RasGEF RasGEF_N RhoGEF Histone PH PH_10 IQ_SEC7_PH PH_13
Motif
Other DBs
NCBI-GeneID: 101098862
NCBI-ProteinID: XP_011279463
Ensembl: ENSFCAG00000024874
UniProt: M3X7C9
Position
A3
AA seq 1333 aa AA seqDB search
MQAQQLPYEFFSEENAPKWRGLLVPALKKVQGQVHPTLESSDDALQYVEELILQLLNMLC
QAQPRSASDVEERVQKSFPHPIDKWAIADAQSAIEKRKRRNPLSLPVEKIHPLLKEVLGY
KIDHQVSVYIVAVLEYISADILKLVGNYVRNIRHYEITKQDIKVAMCADKVLMDMFHQDV
EDINILSLTDEEPSTSGEQTYYDLVKAFMAEIRQYIRELNLIIKVFREPFVSNSKLFSAN
DVENIFSRIVDIHELSVKLLGHIEDTVEMTDEGSPHPLVGSCFEDLAEELAFDPYESYAR
DILRPGFHDRFLSQLSKPGAALYLQSIGEGFKEAVQYVLPRLLLAPVYHCLHYFELLKQL
EEKSEDQEDKECLKQAITALLNVQSGMEKICSKSLAKRRLSESACRFYSQQMKGKQLAIK
KMNEIQKNIDGWEGKDIGQCCNEFIMEGTLTRVGAKHERHIFLFDGLMICCKSNHGQPRL
PGASNAEYRLKEKFFMRKVQINDKDDTSEYKHAFEIILKDENSVIFSAKSAEEKNNWMAA
LISLQYRSTLERMLDVTMLQEEKEEQMRLPSADVYRFAEPDSEENIIFEENTQPKAGIPI
IKAGTVIKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLIIERFEIPEPEPTEADR
IAIENGDQPLSAELKRFRKEYIQPVQLRVLNVCRHWVEHHFYDFERDADLLQRMEEFIGT
VRGKAMKKWVESITKIIQRKKIARDNGPGHNITFQSSPPTVEWHISRPGHIETFDLLTLH
PIEIARQLTLLESDLYRAVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIV
ETENLEERVAVVSRIIEILQVFQELNNFNGVLEVVSAMNSSPVYRLDHTFEQIPSRQKKI
LEEAHELSEDHYKKYLAKLRSINPPCVPFFGIYLTNILKTEEGNPEVLKRHGKELINFSK
RRKVAEITGEIQQYQNQPYCLRVESDIKRFFENLNPMGNSMEKEFTDYLFNKSLEIEPRN
PKPLPRFPKKYSYPLKSPGVRPSNPRPGTMRHPTPLQQEPRKISYSRIPESETESTASAP
NSPRTPLTPPPASGASSTTDVCSVFDSDHSSPFHSSSDTVFVQVSLPHGPRSASVSSISL
TKGTDEVPVPPPVPPRRRPESAPAESSPSKIMSKHLDSPPAIPPRQPTSKAYSPRYSIAD
RTSISDPPESPPLLPPREPVRTPDVFSSSPLHLQPPPLGKKSDHGNAFFPNSPSPFTPPP
PQTPSPHGTRRHLPSPPLTQEVDLPSITGPPVPPRQSTSQHIPKLPPKTYKREHTHPSMH
RDGPPLLENAHSS
NT seq 4002 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcgcagcagctgccgtacgagtttttcagcgaggagaacgcacccaagtggcgg
gggctgctggtgccggcgctgaaaaaggtccaggggcaagttcatcctactcttgagtct
agtgatgatgctcttcagtatgttgaagaattaatcttgcagttattaaatatgctatgc
caagctcagccccgaagtgcttcagatgtagaggaacgtgttcaaaaaagtttccctcat
ccaattgataagtgggcaatagctgatgcccaatcggctattgaaaagaggaagcgaaga
aaccctttatctctcccagtagaaaaaattcatcctttattaaaggaggtcctaggttat
aaaattgaccaccaggtttctgtttacatagtagcagtattagaatacatttctgcagac
attttaaagctggtggggaattatgtacgaaatatacggcattatgaaattacaaaacaa
gatattaaagtggcaatgtgtgctgataaggtattgatggatatgtttcatcaagatgta
gaagatataaatatattatctttaaccgatgaagagccttccacctcaggagagcaaact
tactatgatttggtaaaagcatttatggcagaaattcgacagtacataagggaactaaat
ttaattataaaagtttttagagagccctttgtctccaattcaaaattattttcagctaat
gacgtagaaaatatatttagtcgtatagtagatatacatgaacttagtgtaaagttactg
ggccatatagaagatactgtggaaatgactgatgaaggtagtccccatcccttagtagga
agctgctttgaagacttagcagaggaactggcatttgatccatatgaatcatatgctcga
gatatcttacggcctggttttcatgatcgtttccttagtcagttatcaaagccaggagca
gcactctatttacagtcaataggcgaaggtttcaaagaagctgttcaatatgttttaccc
aggctacttctagcccctgtttaccactgtctgcattactttgagcttttgaagcagtta
gaagaaaagagtgaagatcaagaagacaaggaatgtttgaaacaagcaataacagctttg
cttaatgttcagagtggtatggaaaaaatatgttctaaaagtcttgcaaaacgaagactg
agtgaatctgcatgtcggttttatagtcagcaaatgaaggggaaacaactagcaatcaag
aaaatgaacgagattcagaagaatattgatggttgggagggaaaagacattggacagtgt
tgcaatgaatttataatggaaggaactcttacacgtgtaggagccaagcatgagagacac
atatttctctttgatggcttaatgatttgctgtaaatcaaatcatgggcagccaagactt
cctggtgctagcaatgcagagtatcgtctgaaagaaaagtttttcatgagaaaggtacaa
attaatgacaaagatgacaccagtgagtacaagcatgcttttgaaataattttaaaagat
gaaaatagtgttatattttctgccaagtcagctgaagagaaaaacaattggatggcagca
ctgatatctctccagtaccggagcacactggaaaggatgcttgacgtgacgatgctacag
gaagagaaggaggagcagatgaggctccctagtgctgatgtctatcgatttgcagagcct
gactccgaagagaatataatatttgaagagaacacacagcccaaggctggaattccaatt
atcaaagcaggaactgttattaaacttattgagaggctcacgtaccatatgtacgcagat
cccaattttgttcggacatttcttacaacatacagatccttttgtaaacctcaagaacta
ctgagtcttataatagaaaggtttgaaattccagagcctgagccaacagaagctgatcgc
atagctatagagaatggagatcaacccttgagtgcagaactaaaaaggtttaggaaagaa
tacatacagcctgtacaactgcgagtattaaatgtatgtcggcattgggtagagcaccat
ttctatgattttgaaagagatgcagatcttttgcagcgaatggaagagtttattggaaca
gtaagaggtaaagcaatgaaaaaatgggttgaatccatcactaaaataatccaaaggaaa
aaaattgcaagagacaatggaccaggtcataatattacatttcagagttcacctcccaca
gttgagtggcatataagcaggcctgggcacatagagacttttgacctgctcaccttacac
ccaatagaaattgctcgacaactcactttacttgaatcagatctatatcgagctgtacag
ccatcagaattagttggaagcgtgtggacaaaagaagacaaagaaattaattctcctaat
ctcctaaaaatgatccggcacaccactaacctcactctgtggtttgagaaatgtattgta
gaaactgaaaacttagaagaaagagtagctgtggtgagtcgaataattgagattctacaa
gtctttcaagagctgaacaatttcaatggtgtcctggaggttgtcagtgctatgaactca
tcacctgtttacagactagaccacacatttgagcaaataccaagtcgccaaaagaaaatt
ttagaagaagctcatgaattaagcgaagatcactataagaaatatttggcaaaactcagg
tctattaatccaccgtgtgtgcctttctttggaatttatctaactaatatcttgaaaaca
gaagaaggcaaccctgaggtcctaaaaaggcatggaaaagagcttataaactttagcaaa
aggaggaaagtagcagaaataacaggagagatccagcagtaccaaaatcagccttattgt
ttacgagtagaatcagatatcaaaaggttctttgaaaatttgaatccaatgggaaatagc
atggaaaaagaatttacagattatcttttcaacaaatccttagaaatagaaccgcgaaac
cctaagcctctcccaagatttccaaaaaaatacagctatcccctaaaatctcctggtgtt
cgtccatcaaacccaagaccaggtaccatgagacatcccacacctctgcagcaggagcca
aggaaaattagttacagtaggatccccgaaagtgagacagaaagtacagcatctgcacca
aactctccaagaacaccgttaacacctcctcctgcttcgggtgcttctagtaccacagat
gtttgcagcgtatttgactctgatcattcgagcccttttcactcaagcagcgataccgtc
tttgtccaagtttcactgccccatggcccaagatctgcttcagtatcatctataagttta
accaagggcactgacgaagtgcctgtcccccctcctgttcctccacgaagacggccagaa
tctgcccccgcggaatcttcgccatctaagattatgtctaagcatttggacagcccccca
gcaattcctcctagacagcccacatcaaaagcctattcaccgcggtattcaatagcagac
cggacctctatatcagaccctcccgagagccctcccttattaccaccgcgagaacctgtg
aggacacctgatgttttctccagctcaccactacatctccagcctccccctttgggcaaa
aaaagcgatcatggcaatgccttcttcccaaacagcccttccccatttacgccacctcct
cctcaaacaccttctcctcatggcacgagaaggcatctgccatcaccaccactgacacaa
gaagtggaccttccttccatcactgggccgccggttcctccacgacaaagcacttctcag
catatccctaaactccctccaaaaacttacaaaagggagcacacacacccctccatgcac
agagatggaccacccctgttggagaacgcccattcttcctga

DBGET integrated database retrieval system