KEGG   Felis catus (domestic cat): 101089019Help
Entry
101089019         CDS       T02385                                 

Gene name
GPX2
Definition
(RefSeq) glutathione peroxidase 2
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00480  Glutathione metabolism
fca00590  Arachidonic acid metabolism
fca01100  Metabolic pathways
fca04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    101089019 (GPX2)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    101089019 (GPX2)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    101089019 (GPX2)
Enzymes [BR:fca01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     101089019 (GPX2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx
Motif
Other DBs
NCBI-GeneID: 101089019
NCBI-ProteinID: XP_003987784
Position
B3
AA seq 190 aa AA seqDB search
MAYIAKSFYDLSAISLDGEKVDFNTFRGRAVLIENVASLUGTTTRDFTQLNELQCRFPRR
LVVLGFPCNQFGHQENCQNEEILNSLKYVRPGGGFQPTFTLVQKCEVNGQNEHPVFAYLK
DKLPYPYDDPFSLMTDPKFIIWSPVRRSDVAWNFEKFLIGPEGEPFRRYSRTFPTINIEP
DIKRLLKVAI
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggcttacatagccaagtctttctacgacctcagcgctatcagcctggatggggagaag
gtagatttcaatacgttccgaggcagggcagtgctgattgagaatgtggcctcgctctga
ggcacaaccactcgggacttcacccagctcaacgagctgcaatgccgctttcccaggcgc
ctggtggttcttggcttcccttgcaatcaatttggacatcaggagaactgtcagaatgag
gagatcctgaacagtctcaagtatgtgcgccctgggggtggattccagcccacctttacc
cttgtccaaaagtgtgaggtgaatggtcagaacgagcatcccgtcttcgcctacctgaag
gacaagctcccctacccgtatgatgacccattttccctcatgaccgaccccaagttcatc
atttggagcccggtacgccgctcagatgtggcctggaactttgagaagttccttattggg
ccggaaggggagcccttccgccgctacagtcgcaccttccctaccatcaacattgagcct
gacatcaagcgcctcctcaaagttgccatatag

DBGET integrated database retrieval system