KEGG   Felis catus (domestic cat): 101089037Help
Entry
101089037         CDS       T02385                                 

Gene name
MLH1
Definition
(RefSeq) DNA mismatch repair protein Mlh1 isoform X1
  KO
K08734  DNA mismatch repair protein MLH1
Organism
fca  Felis catus (domestic cat)
Pathway
fca01524  Platinum drug resistance
fca03430  Mismatch repair
fca03460  Fanconi anemia pathway
fca05200  Pathways in cancer
fca05210  Colorectal cancer
fca05213  Endometrial cancer
fca05226  Gastric cancer
Module
fca_M00295  BRCA1-associated genome surveillance complex (BASC)
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    101089037 (MLH1)
   03460 Fanconi anemia pathway
    101089037 (MLH1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101089037 (MLH1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101089037 (MLH1)
   05226 Gastric cancer
    101089037 (MLH1)
   05213 Endometrial cancer
    101089037 (MLH1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    101089037 (MLH1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:fca03400]
    101089037 (MLH1)
DNA repair and recombination proteins [BR:fca03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    MutL homologs
     101089037 (MLH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mlh1_C DNA_mis_repair HATPase_c_3 HATPase_c
Motif
Other DBs
NCBI-GeneID: 101089037
NCBI-ProteinID: XP_019666513
Ensembl: ENSFCAG00000001371
UniProt: M3VWJ1
Position
C2
AA seq 758 aa AA seqDB search
MSLVAGVIRRLDETVVNRIAAGEVIQRPANAIKEMIENCLDAKATSIQVVVKEGGLKLIQ
IQDNGTGIRKEDLDIVCERFTTSKLQSFEDLASISTYGFRGEALASISHVAHVTITTKTA
DAKCAYRASYSDGKLTAPPKPCAGNQGTQITVEDLFYNISTRRKALKNPSEEYGKILEVV
GRYSIHNSGIGFSVKKQGETVADVRTLPSATTVDNIRSIFGNAVSRELIEVGCEDKTLAF
KMNGFISNANYSVKKCIFLLFINHRLVESASLRKAIETVYAAYLPKNTHPFLYLSLEISP
QNVDVNVHPTKHEVHFLHEDSILERVQQHIESKLLGSNSSRMYFTQTLLPGLAGPSGEVV
KSTMGVTPSSTSGSSDKVYAHQMVRTDSREQKLDAFMQPVSKALSGQPQAVVPEDGPEAS
SSRARQQDEEMLELPEPAAVAATNQGLEGDATEGTSQASEKRGPPSSPGNPRKRPRESSD
VEMVEDDSRKEMTAACTPRRRIINLTSVLSLQEEINERGHETLREMLHNHSFVGCVNPQW
ALAQHQTKLYLLNTTKLSEELFYQILIYDFANFGVLRLSEPAPLFDLAMLALDSPESGWT
EEDGPKEGLAEYIVEFLKKKAEMLADYFSLEIDEEGNLIGLPLLIDNYVPPLEGLPLFIL
RLATEVNWDEEKECFESLSKECAMFYSIRKQYVCEESTLSGQQSDVPGSSANPWKWTVEH
IVYKAFRSHLLPPKRFTEDGNILQLANLPDLYKVFERC
NT seq 2277 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctcgtagcgggggttattcggcggctggacgaaacagtggtgaaccgcatcgcg
gcaggggaagtcatccagcggccggccaacgccatcaaggagatgattgagaactgctta
gatgcaaaagccaccagcatccaagtggttgttaaagagggaggcctcaagttgattcag
atccaagacaatggcactgggatccggaaagaagatctggatattgtgtgtgagaggttc
actacaagtaaactgcagtcctttgaggatttagctagtatttctacctatggctttcgg
ggtgaggctttggccagcatcagccacgtggctcacgttactattacgaccaaaacagct
gatgcaaagtgcgcatacagagcaagttactcagatggaaagctgacagctcctcctaaa
ccatgtgcaggcaatcaggggacccagattacggtggaagatctcttttacaacatatcc
acaaggaggaaagctttaaaaaatccgagtgaagagtatgggaaaattttggaagttgtt
ggcaggtattcgatacacaattcaggcattggtttctcagttaaaaaacaaggcgagaca
gtggctgacgttagaacactgcccagtgccacgactgtagacaatattcgctccattttt
ggaaatgctgttagccgagagctgatagaagtcgggtgtgaggataaaaccctagccttc
aaaatgaatggctttatatccaatgcaaattactccgtgaagaagtgtatcttcttactc
ttcatcaaccatcgtctggtagagtcagcttccttaagaaaagccattgaaaccgtgtat
gcagcctatttgcccaaaaacacacacccgttcctgtacctcagtttggagatcagcccc
cagaacgtggatgtcaacgtgcaccccacaaagcacgaggttcacttcctacacgaggac
agcatcctggagcgggtgcaacagcacattgagagcaagctcctgggctccaactcgtcc
aggatgtacttcacccagactttactcccaggtcttgctggcccctctggggaggtggtt
aagtccacaatgggtgtgaccccctcatccacttctggaagcagcgacaaggtctatgct
caccagatggtccgcacagattcgcgggaacagaagctcgatgcgtttatgcagcctgtg
agcaaggctctgtccggtcagcctcaggccgtggtcccagaagatgggcctgaggcttcc
agcagcagggccaggcagcaggatgaggaaatgctcgaactcccggagcctgctgcagtg
gctgccacaaatcagggcttggagggggatgcaacagaggggacttcgcaagcgtcggag
aagagagggcccccttccagcccaggtaaccccagaaagaggccccgggaaagctctgat
gtggaaatggtggaagatgattcccggaaggaaatgacagcagcttgtactccccggaga
aggatcatcaacctcaccagtgtcctgagcctccaggaagaaattaatgagcggggacat
gagactctccgagagatgttgcacaaccactccttcgtgggctgcgtgaatcctcagtgg
gccttggcacagcatcagaccaagctataccttctcaacaccaccaaacttagtgaagaa
ctgttctaccagatactcatttatgattttgccaattttggtgttctgaggctgtcggag
ccagcgccactctttgacctggccatgctcgccttagacagtcccgagagtggctggaca
gaggaggatggccccaaagaaggacttgctgagtacattgttgagtttctaaagaagaag
gctgagatgcttgcggactatttctccttggagatcgatgaggaagggaacctgattgga
ttacccctgctgatcgacaactacgtgccccctttggagggcctgcctctcttcattctt
cgactagccaccgaggtgaactgggatgaagaaaaggaatgttttgaaagcctcagcaaa
gagtgtgctatgttttactccatccggaagcagtatgtatgtgaggagtcgaccctctca
ggccagcagagtgacgtgcctggctcctcagcaaacccctggaagtggactgtggaacac
atcgtctataaagccttccgctcacaccttctgcctcctaaacgtttcacggaagatgga
aatatcctacagcttgccaacctgcccgatctatacaaagtcttcgagagatgttaa

DBGET integrated database retrieval system