KEGG   Felis catus (domestic cat): 101089164Help
Entry
101089164         CDS       T02385                                 

Gene name
KAT8
Definition
(RefSeq) histone acetyltransferase KAT8 isoform X1
  KO
K11308  histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
fca  Felis catus (domestic cat)
Brite
Enzymes [BR:fca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101089164 (KAT8)
Chromosome and associated proteins [BR:fca03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    101089164 (KAT8)
   HAT complexes
    NSL complex
     101089164 (KAT8)
    MSL complex
     101089164 (KAT8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MOZ_SAS Tudor-knot Myosin_head Acetyltransf_7 HTH_9 SAWADEE
Motif
Other DBs
NCBI-GeneID: 101089164
NCBI-ProteinID: XP_003998685
Ensembl: ENSFCAG00000002605
UniProt: M3VYT8
Position
E3
AA seq 458 aa AA seqDB search
MAAQGAAAAVAAATSGVAGESDPGPGENAAVEGTAPSPGRVSPPTPARGEPEVTVEIGET
YLCRRPDSTWHSAEVIQSRVNDQEGREEFYVHYVGFNRRLDEWVDKNRLALTKTVKDAVQ
KNSEKYLSELAEQPERKITRNQKRKHDEINHVQKTYAEMDPTTAALEKEHEAITKVKYVD
KIHIGNYEIDAWYFSPFPEDYGKQPKLWLCEYCLKYMKFEKSYRFHLGQCQWRQPPGKEI
YRKSNISVYEVDGKDHKIYCQNLCLLAKLFLDHKTLYFDVEPFVFYILTEVDRQGAHIVG
YFSKEKESPDGNNVACILTLPPYQRRGYGKFLIAFSYELSKLESTVGSPEKPLSDLGKLS
YRSYWSWVLLEILRDFRGTLSIKDLSQMTSITQNDIISTLQSLNMVKYWKGQHVICVTPK
LVEEHLKSAQYKKPPITVDSVCLKWAPPKHKQVKLSKK
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggcggcacagggagcagctgctgcggttgcggcggctacttcaggggtcgcgggggag
agcgatcccgggcccggggagaatgcggcggtcgaggggaccgccccgtccccgggccgc
gtctctcccccgactccagcgcgcggcgagccggaagtcaccgtggagatcggagaaacg
tacctgtgccgacgaccggatagcacctggcattctgctgaagtgattcagtctcgagtg
aatgatcaggagggccgagaggaattctatgtacactacgtgggctttaaccggcgacta
gacgaatgggtagacaagaaccggctggcactgaccaaaacagtaaaagatgccgtgcag
aagaactcagagaagtacctgagcgagctggctgagcagcctgagcgcaagatcactcgc
aaccaaaagcgcaagcatgatgagatcaaccacgtgcagaagacctatgcagagatggac
cccacaacagcagccttggagaaggaacatgaggcgatcaccaaggtgaagtatgtggac
aagatccacatcgggaactatgaaatcgatgcctggtacttctcaccgttccccgaggac
tatgggaaacagcccaagctgtggctctgcgagtactgccttaagtacatgaaattcgag
aagagctaccgcttccacttggggcagtgtcagtggcggcaacccccagggaaggagatc
tatcgcaagagcaacatctctgtgtacgaggtggatggcaaagaccacaagatttactgt
cagaacctgtgtctgctggccaagcttttcctggaccacaagacgttgtacttcgacgtg
gagcccttcgtcttttacatcttgactgaagtggacaggcagggggcccacattgttggc
tacttctctaaggagaaggagtctccagatgggaacaatgtggcctgcatcctgactctg
cccccctaccagcggcgtggctatggaaaattcctcattgctttcagttacgagctctcc
aagctagagagcacagtaggctcccctgagaagccactgtctgacctgggcaagctcagc
taccgcagctactggtcttgggtcctgctggagattctgcgagacttccggggcacactg
tccatcaaggatcttagtcagatgaccagcatcacccagaatgacatcatcagcacccta
cagtccctcaatatggtcaagtactggaagggccagcatgtgatctgtgtcacacccaag
ctggtagaagaacacctcaaaagtgctcagtataagaaaccacccataacagtggactct
gtctgtctcaagtgggccccccccaagcacaagcaagtgaaactctccaagaagtga

DBGET integrated database retrieval system