KEGG   Felis catus (domestic cat): 101089198Help
Entry
101089198         CDS       T02385                                 

Gene name
JAG2
Definition
(RefSeq) protein jagged-2 isoform X1
  KO
K21635  jagged-2
Organism
fca  Felis catus (domestic cat)
Pathway
fca01522  Endocrine resistance
fca04330  Notch signaling pathway
fca04658  Th1 and Th2 cell differentiation
fca05200  Pathways in cancer
fca05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    101089198 (JAG2)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    101089198 (JAG2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101089198 (JAG2)
  09162 Cancer: specific types
   05224 Breast cancer
    101089198 (JAG2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101089198 (JAG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EGF hEGF MNNL DSL EGF_2 EGF_CA NTP_transf_3
Motif
Other DBs
NCBI-GeneID: 101089198
NCBI-ProteinID: XP_023111900
Ensembl: ENSFCAG00000031155
Position
B3
AA seq 1204 aa AA seqDB search
MRAQARGRLPGRLLLLLALCVQAARPMGYFELQLSALRNVNGELLSGACCDGDGRTTRAG
GCGHDECDTYVRVCLKEYQAKVTPTGPCSYGHGATPVLGGNSFYLPPAGAAGDRARARAR
AGGDKDPGLVVIPFQFAWPRSFTLIVEAWDWDNDTTPDEELLIERVSHAGMINPEDRWKS
LHFSGHVAHLELQIRVRCDENYYSATCNKFCRPRDDFFGHYTCDQYGNKACMDGWMGQEC
KEAVCKQGCNLLHGGCAVPGECRCSYGWQGRFCDECVPYPGCVHGSCVDPWQCNCETNWG
GLLCNKDLNYCGSHHPCTNGGTCINAEPDQYHCACPDGYSGKNCERAEHACASDPCANGG
SCHEVPSGFECHCPSGWSGPTCALDIDECASNPCAAGGTCVDQVDGFECICPEQWVGATC
QLDIKDCRGQCQHGGICKDLATGYQCVCPRGFGGRHCELQLNSCASNPCHGGLCEDLGDG
FRCRCSKGTSGPLCEVDVDFCQPSPCQNGARCYNLEGDYYCACPDDVGGKNCSVPRESCP
GGACRVIDGCGFESESRVAGRAPSGVCGPHGHCVSLPGGNFSCVCDSGFTGAYCHENIDD
CLGQPCRNGGTCIDEVDAFRCFCPSGWEGELCDTNPNDCLPDPCHSRGRCYDLVNDFYCA
CDDGWKGKTCHSREFQCDAYTCSNGGTCYDSGDTFRCACPPGWKGSTCNIAENSSCLPNP
CVNGGTCVGSGDSFSCICRDGWEGRTCTHNTNDCNPLPCYNGGVCVDGVNWFRCECAPGF
AGPDCRINIDECQSSPCAYGATCVDEINGYRCSCPPGRAGPRCQDVIVFGRSCWSQGVPF
PHGGSWVEDCNSCRCVDGRRDCSKVWCGRKPCLLAGRPDALSAQCPPGQRCREKAPGQCL
QPPCAAWGECGADEPLPPSTLCLPRSSHLDNNCARLTLHFNRDRVPQGTTVGAICSGIRA
LPATRAVARDRLLVLLCDRPSSGASAVEVAVSFSPARDLPDSGLIQSTAHAIVAAITQRG
NSSLLLAITEVKVETVVVGGSSVGLLVPVLCGVFSVLCLACVVVCVWWTRKRRKERERSR
LPREESANNQWAPLNPIRNPIERPGVGGHKDALYPCKNFTPPPRRVGELLPGPAGCRAGG
GEDDDDEEPGRAEGDCLEAEKFLSHKFTKDPSCSPGRPARWASGPKVDNRAVRSASDSRH
AGPE
NT seq 3615 nt NT seq  +upstreamnt  +downstreamnt
atgcgggcgcaggcccgggggcgactgccggggcggctgctgctgctgctggcgctctgc
gtgcaggcggcacggcccatgggctatttcgagctgcagctgagcgcgctgcggaacgtg
aacggggagctgctgagcggcgcctgctgtgacggcgacggccggacgacgcgcgcgggg
ggctgcggccacgacgagtgcgacacgtacgtgcgcgtgtgcctcaaggaataccaggcc
aaggtgacgcccacggggccctgcagctacggccacggcgccacgcccgtgctgggcggc
aactccttctacctgccgccggcgggcgccgcgggggatcgggcgcgggcacgggcccgg
gccggaggcgacaaggaccccggcctcgtcgtcatccccttccagttcgcctggccgcgc
tccttcaccctcatcgtggaggcctgggactgggacaatgacaccaccccggatgaggag
ctgctgatcgagcgggtgtcgcacgcgggcatgatcaaccccgaggaccgctggaagagc
ctgcacttcagcggccatgtggcgcacctggagctgcagatccgcgtgcgctgcgacgag
aactattacagcgccacgtgcaacaagttctgccggccgcgcgacgacttcttcggccac
tacacctgcgaccagtatggcaacaaagcctgcatggacggctggatgggccaggagtgc
aaggaggcggtgtgtaaacaggggtgtaatctgctccacggggggtgtgccgtgcccggg
gaatgcaggtgcagctacggctggcaggggcggttctgcgacgagtgcgtcccataccct
ggctgtgtccacggcagctgtgtggatccctggcagtgcaattgtgagaccaactggggc
ggtctgctctgcaacaaagacctgaactactgcggcagccaccacccttgcaccaacggg
ggcacgtgcatcaacgcggagcccgaccagtaccactgcgcctgtcccgatggctactcg
gggaagaactgtgagcgggccgagcacgcctgtgcctccgacccgtgcgccaacgggggc
tcttgtcacgaggtgccctctggcttcgaatgccactgcccatcaggctggagcgggccc
acctgtgctctcgacatcgacgagtgtgcctccaacccctgcgcggcagggggcacctgc
gtggaccaggtggacggcttcgagtgcatctgccccgagcagtgggtgggggccacctgc
cagctggacatcaaggactgtcgtgggcagtgtcagcacggtggcatctgcaaagacctg
gcgaccggctaccagtgtgtgtgcccacggggcttcggcggccggcactgtgagctgcag
ctgaactcgtgtgccagcaacccctgccatggtggcctctgtgaggacctgggggacggc
ttccgctgccgctgctccaagggcacctcggggccgctctgcgaggtagacgtagacttc
tgtcagcccagcccctgccagaacggagctcgctgctacaacctggagggcgactattac
tgcgcatgccctgacgacgtgggcggcaagaactgttctgtgcccagggagtcgtgcccg
ggcggggcctgcagagtgatcgatgggtgcgggtttgagtcggagtccagagtggcgggc
agggccccttctggtgtatgtggtccccacggacactgcgtcagcctgcctgggggcaac
ttctcctgcgtgtgcgacagcggcttcacgggcgcctactgccatgagaacatcgacgat
tgcctggggcagccgtgccgcaatgggggcacgtgcatcgatgaggtggacgcattccgc
tgcttctgccccagcggctgggagggcgagctctgtgacactaatcccaacgactgcctt
cccgatccctgccacagccgcggccgctgctacgacctggtcaacgacttctattgcgcc
tgtgacgacggctggaagggcaagacctgccactcgcgcgagttccagtgtgatgcctac
acctgtagcaacggtggcacgtgctatgacagcggggacaccttccgctgtgcctgcccc
ccgggctggaagggcagcacctgcaacatagccgagaacagcagctgcctgcccaacccc
tgcgtgaacgggggcacctgcgtgggcagcggggactccttctcctgcatctgccgggac
ggctgggagggccgcacctgcacgcacaataccaacgactgcaatcccctgccttgctac
aacggtggtgtctgcgttgacggggtcaactggttccgctgcgagtgtgcccctggcttc
gcgggtcccgactgccgcatcaatatcgacgagtgccagtcctcgccttgtgcctacggg
gccacgtgcgtggatgagatcaacggctatcgatgcagctgcccgccaggccgggccggc
ccacggtgccaggacgtgattgtctttgggaggtcctgctggtcacagggcgtacccttc
ccgcacgggggctcctgggtggaggattgtaacagctgccgctgcgtggacggtcgccgg
gactgcagcaaggtgtggtgcgggcggaagccttgcctgctggccggccggcccgacgcc
ctaagcgcccagtgcccgccagggcagcggtgccgggagaaggcccccggccagtgcctg
cagccgccctgcgcggcgtggggcgagtgtggcgccgacgagcccctgccgcccagcacc
ctgtgcttgccgcgctccagccacttggacaacaactgtgcacgcctcactttgcacttc
aatcgagaccgagtgccccagggcaccaccgtgggcgccatctgctccgggatccgcgcc
ctgcccgccacaagggcggtggcccgtgaccgcctgctggtgctgctctgtgaccggccg
tcttctggggccagcgcagtcgaggtggctgtgtccttcagccccgcgagggacctgccc
gacagcggcctgatccagagcacggcacacgccatcgtagccgccatcacccagcggggc
aacagctcgctgctgttggcgatcaccgaggtcaaagtggagacggtggtcgtgggcggc
tcttccgtgggtctgctggtgccggtgctgtgcggcgtgttcagcgtgctgtgtctggcg
tgtgtggtcgtttgcgtgtggtggacccggaagcgcaggaaagagcgggagaggagccgg
ctgccgcgggaggagagcgccaacaaccagtgggcccctctcaaccccatccgcaacccc
atcgagcggccgggcgtcggcggccacaaagacgcgctgtacccgtgcaagaacttcacg
ccgccgccgcgccgggtgggcgagctgctgcccgggcccgcgggctgcagggcaggcggg
ggggaggacgacgacgacgaggagcccggccgcgccgagggtgactgcctggaggccgag
aagttcctctcccacaaattcaccaaagaccccagctgctcgcccgggaggccggcccgc
tgggcctcgggccccaaagtggacaaccgcgcggtcaggagcgccagtgactcgcgccac
gccggcccggagtag

KEGG   Felis catus (domestic cat): 101093427Help
Entry
101093427         CDS       T02385                                 

Gene name
JAG1
Definition
(RefSeq) protein jagged-1
  KO
K06052  jagged-1
Organism
fca  Felis catus (domestic cat)
Pathway
fca01522  Endocrine resistance
fca04330  Notch signaling pathway
fca04371  Apelin signaling pathway
fca04658  Th1 and Th2 cell differentiation
fca04668  TNF signaling pathway
fca05165  Human papillomavirus infection
fca05200  Pathways in cancer
fca05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    101093427 (JAG1)
   04371 Apelin signaling pathway
    101093427 (JAG1)
   04668 TNF signaling pathway
    101093427 (JAG1)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    101093427 (JAG1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101093427 (JAG1)
  09162 Cancer: specific types
   05224 Breast cancer
    101093427 (JAG1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101093427 (JAG1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101093427 (JAG1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:fca04090]
    101093427 (JAG1)
CD molecules [BR:fca04090]
 Proteins
  101093427 (JAG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EGF hEGF MNNL EGF_2 DSL EGF_CA cEGF EGF_3 MAP17
Motif
Other DBs
NCBI-GeneID: 101093427
NCBI-ProteinID: XP_003983833
Ensembl: ENSFCAG00000002195
UniProt: M3VY27
Position
A3
AA seq 1218 aa AA seqDB search
MRSPRTRGRPGRPLSLLLALLCALRAKVCGASGQFELEILSMQNVNGELQNGNCCGGVRN
PGDRKCSHDECDTYFKVCLKEYQSRVTAGGPCSFGSGSTPVIGGNTFNLKASRGNERNRI
VLPFSFAWPRSYTLLVEAWDSSNDTLQPDSIIEKASHSGMINPSRQWQTLKQNTGIAHFE
YQIRVTCDDYYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPECNKAICRQGCSP
KHGSCKLPGDCRCQYGWQGLYCDKCIPHPGCVHGTCNEPWQCLCETNWGGQLCDKDLNYC
GTHQPCLNGGTCSNTGPDKYQCSCPEGYSGPNCEIAEHACLSDPCHNRGSCRETSLGFEC
ECSPGWTGPTCSTNIDDCSPNNCSHGGTCQDLVNGFKCVCPPQWTGKTCQLDANECEAKP
CVNAKSCKNLIASYYCDCLPGWTGQNCDININDCLGQCQNDASCRDLVNGYRCICPPGYA
GDHCERDIDECASNPCLNGGHCQNEINRFQCLCPTGFSGNLCQLDIDYCEPNPCQHGAQC
YNRASDYFCKCPEDYEGKNCSHLKDHCRTTPCEVIDSCTVAMASNDTPEGVRYISSNVCG
PHGKCKSQSGGKFTCDCNKGFTGTYCHENINDCESNPCKNGGTCIDGVNSYKCICSDGWE
GAYCETNINDCSQNPCHNGGSCRDLVNDFYCDCKNGWKGKTCHSRDSQCDEATCNNGGTC
YDEGDAFKCMCPGGWEGTTCNIARNSSCLPNPCHNGGTCVVNGDSFTCVCKEGWEGPICT
QNTNDCSPHPCYNSGTCVDGDNWYRCECAPGFAGPDCRININECQSSPCAFGATCVDEIN
GYQCVCPPGHSGAKCQEVSGRPCITMGSVIPDGAKWDDDCNTCQCLNGRIACSKVWCGPR
PCLLHKGHSECPSGQSCIPILDDQCFVRPCTGVGECRSSSLQPVKTKCTSDPYYQDNCAN
ITFTFNKEMMSPGLTTEHICSELRNLNILKNVSAEYSIYIACEPSPSANNEIHVAISAED
IRDDGNPIKEITDKIIDLVSKRDGNSSLIAAVAEVRVQRRPVKNRTDFLVPLLSSVLTVA
WICCLVTAFYWCVRKRRKPSSHARAASEDNTTNNVREQLNQIKNPIEKHGANTVPIKDYE
NKNSKMSKIRTHNSEVEEDDMDKHQQKARFAKQPAYTLVDREEKPPNGTPAKHPNWTNKQ
DNRDLESAQSLNRMEYIV
NT seq 3657 nt NT seq  +upstreamnt  +downstreamnt
atgcggtccccacggacgcgcggccggcccgggcgccccctgagcctcctgctcgccctg
ctctgcgccctgcgagccaaggtgtgcggggcctccggccagttcgaattggagatcctg
tccatgcagaacgtgaatggggagctgcagaacgggaactgctgcggcggcgtccggaac
ccgggggaccgcaagtgctcccacgacgagtgtgacacgtatttcaaagtgtgcctcaag
gagtaccagtcccgcgtcacggccggggggccctgcagcttcggctcgggctccactcct
gtcatcgggggcaacaccttcaatctcaaggccagtcgtggcaacgaacgcaaccgcatc
gtgctgcctttcagtttcgcgtggccgaggtcctacactttgcttgtggaggcgtgggat
tccagcaatgacactctccagcctgacagcattattgaaaaggcttctcactcgggcatg
ataaaccccagcaggcagtggcagacgcttaagcagaacacagggattgcccacttcgag
tatcagatccgcgtcacctgtgatgactattactatggctttggctgcaataagttctgc
cgacccagagatgacttctttggacactatgcctgtgaccagaatggcaacaaaacttgc
atggagggctggatgggccccgaatgtaacaaagctatttgccgacagggctgtagcccc
aagcatgggtcttgcaaactcccaggtgactgcaggtgccagtatggctggcagggcctg
tactgtgacaagtgcatcccgcacccggggtgtgtccatggcacctgtaacgagccctgg
cagtgcctctgtgagaccaactggggcggccagctctgcgacaaagatctcaactactgt
gggactcaccagccctgtctcaacgggggaacttgcagcaacacaggtcctgacaagtat
cagtgttcctgccctgaggggtattcaggacccaactgtgaaatcgcggagcacgcctgc
ctgtctgacccctgccacaacaggggcagctgccgggagacctcgctggggtttgagtgt
gagtgttccccgggctggacgggccccacgtgttccacgaacattgatgactgttctcca
aataactgttcccatgggggtacctgccaggacttggttaatggattcaagtgtgtgtgc
ccgccccagtggactggcaaaacgtgccagttagatgcaaatgagtgcgaggccaaacct
tgtgtaaatgccaaatcctgtaagaatctgattgccagctactactgtgattgccttcca
ggctggacgggtcagaattgtgacataaatattaatgactgccttggccagtgtcagaat
gatgcctcctgtcgggatttggttaatggttatcgctgtatctgtccacctggctatgca
ggcgatcactgtgagagagacatcgatgaatgcgccagcaacccctgtttgaatgggggt
cactgtcagaatgaaatcaacagattccagtgtctgtgtcccactggtttctctggaaac
ctctgtcagctggacatcgattattgtgaacccaatccctgccagcacggtgcccagtgc
tacaaccgcgccagcgactatttctgcaaatgtcctgaggactacgaaggcaagaattgc
tcccaccttaaagatcactgccgcacgactccctgtgaagtgattgacagctgcactgtg
gccatggcttccaatgacacgcctgagggggtgcggtatatttcctcgaacgtctgtggt
ccccacgggaagtgcaagagtcagtcgggaggcaaattcacctgcgactgtaacaaaggc
ttcactggaacgtactgccatgaaaacattaatgactgcgagagcaacccctgtaaaaat
ggcggtacttgcatcgatggtgtcaactcctacaagtgcatctgtagtgacggctgggag
ggggcctactgtgaaaccaacattaacgactgcagccagaatccctgccacaatgggggc
tcgtgtcgtgaccttgtcaacgacttttactgtgactgtaaaaacgggtggaaaggaaag
acatgccactcacgtgacagccagtgtgatgaggccacgtgcaacaacggtggcacctgc
tatgacgaaggggatgctttcaagtgcatgtgtcctggaggctgggaagggacgacctgc
aacatagcccgaaacagtagttgcctgcccaacccttgccataacgggggcacctgtgtg
gtcaacggcgactccttcacgtgtgtctgcaaagaaggctgggaggggcccatctgtact
cagaataccaatgactgcagtcctcacccctgttacaacagtggcacgtgtgtggatgga
gacaactggtaccggtgtgagtgtgccccaggctttgctggacctgactgcagaataaac
atcaacgaatgccagtcttcaccctgtgcctttggggcaacctgtgtggatgagatcaat
ggctaccagtgtgtctgtcccccagggcacagtggtgccaagtgccaagaagtttcaggg
agaccttgtatcaccatggggagtgtgatcccagacggggccaagtgggacgatgactgc
aatacatgccagtgcctgaatggaaggatcgcctgctcgaaggtctggtgtggccctcga
ccttgcttgctccacaaagggcacagtgagtgccccagtgggcaaagctgcatccctatc
ctggatgaccagtgttttgtccgcccctgcacgggtgtgggtgagtgtcggtcttccagt
ctccagcccgtgaagaccaagtgcacttctgacccctactaccaggataactgtgcaaac
atcacattcaccttcaacaaagagatgatgtcgccgggccttaccacggagcatatttgc
agtgaattgaggaatttgaatattttaaagaatgtttccgccgaatactcaatctacata
gcttgtgagccttccccttctgcgaacaatgaaatacatgtggccatttctgctgaagac
atacgggatgatggaaaccctatcaaggaaatcactgacaaaatcatagatctcgttagc
aaacgtgatgggaatagctcgcttattgctgcggttgcggaagtgcgagtgcagaggcgg
cctgtgaagaacagaacagatttcctggttcctctgctgagctccgtcttaactgtggcc
tggatctgttgcctggtgacagccttctactggtgcgtgcggaagcggcggaagcccagc
agccacgctcgtgcggcctctgaggacaacaccaccaacaatgtgcgggagcagctgaac
cagatcaaaaaccccatcgagaagcacggggccaacacggtccccatcaaggattacgag
aacaaaaactccaaaatgtcgaaaataaggacccacaactcggaggtagaggaggacgac
atggacaagcaccagcagaaagcccggtttgccaaacagccggcatacacgctggtagac
agagaagagaagccccccaatggcacgccggccaaacacccaaactggacaaacaaacag
gacaacagggacctggaaagcgcccagagcttaaaccggatggagtacatcgtatag

DBGET integrated database retrieval system