KEGG   Felis catus (domestic cat): 101089230Help
Entry
101089230         CDS       T02385                                 

Gene name
CHP2
Definition
(RefSeq) calcineurin B homologous protein 2
  KO
K17611  calcineurin B homologous protein 2
Organism
fca  Felis catus (domestic cat)
Brite
Protein phosphatases and associated proteins [BR:fca01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     101089230 (CHP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg RST TerB EF-hand_9 DIMCO_N
Motif
Other DBs
NCBI-GeneID: 101089230
NCBI-ProteinID: XP_023102474
Ensembl: ENSFCAG00000026316
Position
E3
AA seq 196 aa AA seqDB search
MGSLGSHAARIPDADSIRRETGFSQASLLRLYHRFRALDRNKKGYLSRMDLQQIGALAVN
PLGERIIDSFFPDGNLRLDFPGFVRVLAHFRPIDDEDPGIRDPKEPEPLNSRMNKLRFAF
QLYDLDRDGKISRHEMLQVLRLMVGVQVTEEQLESIADRTVQEADEDGDGAVSFLEFTKS
LEKMDIEQKMSIRILK
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgggctccctcggctcccacgccgcgcgcatccccgacgcggacagcatccggcgggag
accggcttctcgcaggccagtctgctccgcctctaccaccggtttcgggcactggacagg
aacaagaagggctacctgagccgcatggatctgcagcagattggggctctggccgtgaac
cccttgggagaacgcattatagacagcttcttccctgatgggaatctgcgtctggatttc
ccaggctttgtcagagtcctggctcattttcgccccatcgatgatgaggacccaggaatt
cgagaccccaaggaacctgaacccctcaacagcagaatgaacaaacttcgcttcgcattt
cagctctacgacctggaccgggacggaaagatctcccggcacgagatgctacaggtcctc
cgactgatggttggggtgcaggtgacagaagagcagttggagagcatcgctgatcgcacg
gtgcaggaagcggatgaagatggagatggggctgtgtccttcctggagttcaccaagtcc
ttggagaagatggacatcgaacagaaaatgagcatacggatcctgaagtga

DBGET integrated database retrieval system