KEGG   Felis catus (domestic cat): 101089435Help
Entry
101089435         CDS       T02385                                 

Gene name
GUCY1B1
Definition
(RefSeq) LOW QUALITY PROTEIN: guanylate cyclase soluble subunit beta-1
  KO
K12319  guanylate cyclase soluble subunit beta [EC:4.6.1.2]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00230  Purine metabolism
fca01100  Metabolic pathways
fca04022  cGMP-PKG signaling pathway
fca04270  Vascular smooth muscle contraction
fca04540  Gap junction
fca04611  Platelet activation
fca04713  Circadian entrainment
fca04730  Long-term depression
fca04921  Oxytocin signaling pathway
fca04924  Renin secretion
fca04970  Salivary secretion
Module
fca_M00694  cGMP signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    101089435 (GUCY1B1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    101089435 (GUCY1B1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101089435 (GUCY1B1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101089435 (GUCY1B1)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    101089435 (GUCY1B1)
   04924 Renin secretion
    101089435 (GUCY1B1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101089435 (GUCY1B1)
  09154 Digestive system
   04970 Salivary secretion
    101089435 (GUCY1B1)
  09156 Nervous system
   04730 Long-term depression
    101089435 (GUCY1B1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101089435 (GUCY1B1)
Enzymes [BR:fca01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     101089435 (GUCY1B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc HNOBA HNOB 4_1_CTD
Motif
Other DBs
NCBI-GeneID: 101089435
NCBI-ProteinID: XP_023108514
Ensembl: ENSFCAG00000010512
Position
B1
AA seq 619 aa AA seqDB search
MYGFVNHALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVAAASKVLN
LNAGEILQMFGKMFFVFCQESGYDTILRVLGSNVREFLQNLDALHDHLATIYPGMRAPSF
RCTDAEKGKGLILHYYSEREGLQDIVIGIIKTVAQQIHGTEIDMKVIQQRNEECDHTQFL
IEEKESKEEDFYEDLDRFEENGTQESRISPYTFCKAFPFHIIFDRDLVVTQCGNAIYRVL
PQLQPXNCSLLSVFSLVRPHIDISFHGILSHINTVFVLRSKEGLLDVEKLECEDELTGTE
SSCLRLKGQMIYLPEADSILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFR
EEYKLTQELEILTDRLQLTLRALEDEKKKTDTLLYSVLPPSVANELRHKRPVPAKRYDNV
TILFSGIVGFNAFCSKHASGEGAMKIVNLLNDLYTRFDTLTDSRKNPFVYKVETVGDKYM
TVSGLPEPCIHHARSICHLALDMMEIAGQVQVDGESVQITIGIHTGEVVTGVIGQRMPRY
CLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMTPENSDPQFHLEHRGPVSMKGKKEPMQ
VWFLSRKNTGTEEPAQDDN
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgtacggatttgtgaatcacgcgctggagctgctggtgatccgcaattacggcccggag
gtgtgggaagacatcaaaaaagaggcacagttagatgaagaaggacagtttcttgtcaga
ataatatatgatgattctaaaacttacgatttggttgctgctgcaagcaaagtcctcaat
ctcaatgctggagaaatcctccaaatgtttgggaagatgttttttgtcttttgtcaagaa
tctggttatgatacaatcttgcgtgtcctgggatctaatgtcagagaatttctacagaat
cttgatgctctgcatgaccacctcgctactatctacccaggtatgcgtgcgccttccttt
aggtgcactgatgcagaaaagggcaaaggactcattctgcactactactcagagagagaa
ggacttcaggatattgtcatcggaatcatcaaaacagtagctcaacaaatacatggcact
gaaatagacatgaaggttattcagcaaagaaatgaagaatgtgatcatactcaattttta
attgaggaaaaagagtcaaaagaagaagatttttatgaagatcttgatagatttgaagaa
aacggtacccaggaatcacgcatcagcccgtataccttctgcaaagcttttcctttccac
ataatatttgaccgggacctggtggttactcagtgtggcaatgccatatatagagtgctt
ccccagctccaacctnggaactgcagtctgttgtctgtcttctctctggttcgtcctcat
attgacattagtttccatgggatcctttcgcacatcaatacagtttttgtattgagaagc
aaggaaggactgttggatgtagagaaattagaatgtgaggatgagctgactgggactgag
agcagctgcttacgtctcaaggggcagatgatctacttacctgaagccgatagcatcctt
tttctgtgttcaccaagtgtgatgaacctggacgatctgacaaggagaggtttgtaccta
agtgacatccctctgcatgatgccacgcgtgatctcgttctcttgggagaacaattcaga
gaggaatacaaactgacccaagaactggaaatcctcacagataggctgcagctcacatta
agagccttggaagatgaaaagaaaaagacagacacgctgttgtattctgtcctccctcca
tccgttgccaatgagctgagacacaagcgtccagtgcctgccaagagatacgacaacgtg
accatcctcttcagtggcattgtgggcttcaatgccttctgtagcaagcatgcatctgga
gaaggggccatgaagattgtaaacctgctcaatgacctctacaccagatttgacacactg
actgactcccggaaaaatccatttgtttataaggtggagacagttggtgataagtatatg
acagtgagtggtttaccagagccatgcatccaccatgcacgatccatttgccacctggcc
ttggatatgatggaaattgctggccaggttcaagtagatggagaatctgttcagataacc
atagggatacacactggagaagtagttactggtgtcatagggcagaggatgcctcgatat
tgtctttttggaaatactgttaacctcacaagcagaacagaaaccactggagaaaaggga
aaaataaatgtgtctgaatacacatacagatgtcttatgacaccagaaaactcagatcca
caattccatttggagcacagaggcccagtgtccatgaagggtaaaaaagagccaatgcaa
gtttggtttctatccagaaaaaatacaggaacagaggaaccagcacaggatgataactga

KEGG   Felis catus (domestic cat): 101098377Help
Entry
101098377         CDS       T02385                                 

Gene name
GUCY1A1
Definition
(RefSeq) guanylate cyclase soluble subunit alpha-3
  KO
K12318  guanylate cyclase soluble subunit alpha [EC:4.6.1.2]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00230  Purine metabolism
fca01100  Metabolic pathways
fca04022  cGMP-PKG signaling pathway
fca04270  Vascular smooth muscle contraction
fca04540  Gap junction
fca04611  Platelet activation
fca04713  Circadian entrainment
fca04730  Long-term depression
fca04921  Oxytocin signaling pathway
fca04924  Renin secretion
fca04970  Salivary secretion
Module
fca_M00694  cGMP signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    101098377 (GUCY1A1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    101098377 (GUCY1A1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101098377 (GUCY1A1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101098377 (GUCY1A1)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    101098377 (GUCY1A1)
   04924 Renin secretion
    101098377 (GUCY1A1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101098377 (GUCY1A1)
  09154 Digestive system
   04970 Salivary secretion
    101098377 (GUCY1A1)
  09156 Nervous system
   04730 Long-term depression
    101098377 (GUCY1A1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101098377 (GUCY1A1)
Enzymes [BR:fca01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     101098377 (GUCY1A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc HNOBA HNOB
Motif
Other DBs
NCBI-GeneID: 101098377
NCBI-ProteinID: XP_011279907
Ensembl: ENSFCAG00000010510
UniProt: M3WDE4
Position
B1
AA seq 690 aa AA seqDB search
MFCTKLKDLKITGECPLSLLAPGQAPKEPAEEVAGSSESGKTTLPICQDVPEKNEPRSLP
QRKTSRSRVYLHTLAESICKLIFPELERLNLALQRTLAKHKIKESRKSLEREDFEKIITD
QAIAAGVPAEIIKESLGEELFKICYEEDEHILGVVGGTLKDFLNSFSTLLKQSSHCQEAE
KRGRFEDASILCLDKDHNFLNVYYFFPKRITSLILPGIIKAAAHILYETEVDVSLMPPCF
RTEGSEFVNQPYLLYSLHVKSTKPSLSPGKPQSSLVIPASLFCKTFPFHFMFDKDMTILQ
FGNGIRRLMNRRDFQGKPNFEEYFEILTPKIKQTFSGILTMLNMQFVVRVRRWDNSVKKS
SRVMDLKGQMIYIVESSAVLFLGSPCVDRLEDFTGRGLYLSDIPIHNALRDVVLIGEQAR
AQDGLKKRLGKLKATLEQAHQALEEEKKKTVDLLCSIFPCEVAQQLWQGQVVQAKKFSDV
TMLFSDIVGFTAICSQCSPLQVITMLNALYTRFDRQCGELDVYKVETIGDAYCVAGGLHK
ESDTHAVQIALMALKMMELSDEVMSPHGEPIKMRIGLHSGSVFAGVVGVKMPRYCLFGNN
VTLANKFESCSVPRKINVSPTTYRLLKDCPGFVFTPRSREELPPNFPSEIPGICHFLEAY
QQGTNSKPWFQTKDVEDGNANFLGKASGID
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atgttctgcacgaagctgaaagatctcaagatcacaggagagtgccctttgtccttactg
gcaccggggcaggctcccaaagagcccgcagaagaggtagcaggaagctcagagagtggc
aaaacaactctgcccatctgtcaggatgtgcctgagaagaatgaaccaagaagtcttcct
caaagaaagaccagtaggagccgcgtctaccttcacacgttagcagagagcatttgcaaa
ctgattttcccagagttggagcggctgaaccttgcacttcagagaacattggcaaaacac
aaaataaaagaaagcaggaaatctttggaaagagaagactttgaaaaaataattacagac
caagcaattgcagcaggagttccagcagaaatcatcaaagaatctctcggcgaagagctt
tttaaaatatgttatgaggaagacgaacacatcttaggtgtggttggaggaaccctcaaa
gattttttaaatagcttcagcacccttctgaaacagagcagccactgccaagaggcagaa
aagagaggcaggttcgaggacgcttccattctatgcctggataaagatcacaatttctta
aatgtttactattttttccctaagagaatcacgtctctgattcttcctggcatcattaag
gcagctgctcacattttgtacgaaaccgaagtggatgtgtcactgatgcctccctgcttc
cgtactgaaggcagcgagttcgttaatcagccctatttgttatactcgcttcacgtcaaa
agcaccaagccatccctgtccccgggcaagccccagtcctcgctggtgattcctgcttcc
ctcttctgcaagacctttccttttcatttcatgttcgacaaagacatgacaattctgcag
tttggcaatggcattagaaggctgatgaacaggagagactttcaaggaaagcctaatttt
gaagagtactttgaaattctgactccaaaaatcaagcaaacgttcagtggaatcctgacc
atgttgaacatgcagtttgtggtccgagtgaggaggtgggacaactctgtgaagaaatct
tccagggtgatggacctcaaaggccagatgatctacattgttgaatccagtgcagtcttg
ttcttgggctcaccctgtgtggaccgattagaagattttacgggacgagggctctacctc
tcagacatcccgattcacaatgcactgagggacgtggtgctgataggggagcaggccagg
gcacaggacggcctgaagaagaggctgggcaagctgaaggccacccttgagcaggcccac
caagccctggaggaggagaagaagaagaccgtggatctcctgtgctccatatttccctgc
gaggttgcacagcagctgtggcaagggcaagtcgtgcaagccaagaagttcagtgatgtc
accatgctcttctcagacatcgttgggttcactgccatctgctcccagtgctctccgctg
caggttatcaccatgctcaatgcactctacactcgctttgaccggcagtgcggagagctg
gacgtctacaaggtggagaccattggcgatgcatattgtgtggctgggggattacacaaa
gaaagtgatacccatgctgttcagatagcactgatggccctgaagatgatggagctgtct
gatgaagttatgtctccccatggagaacctatcaagatgcggattggactacattctggg
tcagtttttgctggagtcgtcggcgttaaaatgcctcgttactgtctttttggaaacaac
gtcaccttggcaaacaaatttgagtcctgcagcgtaccacggaaaatcaacgtcagcccg
acaacgtacagattactcaaagactgtcctggttttgtgtttacccctcgatcaagggag
gaactcccaccaaacttccccagtgaaattcctggaatctgtcattttctggaagcttat
caacaaggaacaaattcaaaaccatggttccaaacgaaagatgttgaagatggcaatgcc
aattttttaggcaaagcctcaggaatagattag

KEGG   Felis catus (domestic cat): 101098598Help
Entry
101098598         CDS       T02385                                 

Definition
(RefSeq) guanylate cyclase soluble subunit beta-2-like
  KO
K12319  guanylate cyclase soluble subunit beta [EC:4.6.1.2]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00230  Purine metabolism
fca01100  Metabolic pathways
fca04022  cGMP-PKG signaling pathway
fca04270  Vascular smooth muscle contraction
fca04540  Gap junction
fca04611  Platelet activation
fca04713  Circadian entrainment
fca04730  Long-term depression
fca04921  Oxytocin signaling pathway
fca04924  Renin secretion
fca04970  Salivary secretion
Module
fca_M00694  cGMP signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    101098598
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    101098598
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101098598
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101098598
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    101098598
   04924 Renin secretion
    101098598
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101098598
  09154 Digestive system
   04970 Salivary secretion
    101098598
  09156 Nervous system
   04730 Long-term depression
    101098598
  09159 Environmental adaptation
   04713 Circadian entrainment
    101098598
Enzymes [BR:fca01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     101098598
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HNOBA DIRP D123
Motif
Other DBs
NCBI-GeneID: 101098598
NCBI-ProteinID: XP_023115629
Position
A1
AA seq 252 aa AA seqDB search
MYNLNLYLCPSAAGIIEAVAKDFFDIDVTMDILSMNKEEERTGKKEHVVFLVLRVKQAGV
NIQKYVPGLQNQKIRLDEYFSIIHPQVTFDILSICKFINSQFVLKVRRERMPEAWKSQPA
LKLRGQMIWMESARCMIYLCSPKLRSLRELEAHRMHLSDIAPHDTTRDLILLNQQRLAEI
ELSNQLERKKEELRVLSQHLAIEKKKTETLLYAMLPEHVANQLKEGKKVAAGKAFPPLRG
CLWARVAVCLGG
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtacaacttaaacctctacctgtgtccttctgctgcaggtatcattgaggctgtggcc
aaagacttctttgacattgatgtgaccatggatatcctcagcatgaataaggaagaggag
aggacaggaaagaaagagcatgttgtgtttctggttctgagggtcaagcaagccggagtg
aatattcagaagtatgtcccaggactccaaaaccagaagattcgattggatgagtatttc
tccatcattcatccccaagttaccttcgacattctcagcatctgcaaatttatcaacagt
caatttgtcctgaaggtccgaagagaaaggatgcctgaggcatggaaaagtcagcccgca
ctcaaactgcgaggccagatgatctggatggagtccgcgcggtgcatgatatacctgtgc
tccccgaagctccgcagcctacgagagctggaggcgcaccggatgcacctgtctgacatc
gccccccacgacaccaccagggacctcatcctcctgaaccagcagcggctggcagagatt
gagctgtccaaccagctggagaggaagaaggaggagctgcgggtcctctcccagcacttg
gccatagaaaagaagaaaaccgagaccttgctttatgccatgctgccggaacatgtggcc
aaccagctgaaggagggcaaaaaggtcgctgcgggtaaagcattccctccccttcgtggg
tgcctctgggcaagagtagcggtgtgcctcgggggttag

KEGG   Felis catus (domestic cat): 101099494Help
Entry
101099494         CDS       T02385                                 

Gene name
GUCY1A2
Definition
(RefSeq) guanylate cyclase soluble subunit alpha-2
  KO
K12318  guanylate cyclase soluble subunit alpha [EC:4.6.1.2]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00230  Purine metabolism
fca01100  Metabolic pathways
fca04022  cGMP-PKG signaling pathway
fca04270  Vascular smooth muscle contraction
fca04540  Gap junction
fca04611  Platelet activation
fca04713  Circadian entrainment
fca04730  Long-term depression
fca04921  Oxytocin signaling pathway
fca04924  Renin secretion
fca04970  Salivary secretion
Module
fca_M00694  cGMP signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    101099494 (GUCY1A2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    101099494 (GUCY1A2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101099494 (GUCY1A2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101099494 (GUCY1A2)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    101099494 (GUCY1A2)
   04924 Renin secretion
    101099494 (GUCY1A2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101099494 (GUCY1A2)
  09154 Digestive system
   04970 Salivary secretion
    101099494 (GUCY1A2)
  09156 Nervous system
   04730 Long-term depression
    101099494 (GUCY1A2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101099494 (GUCY1A2)
Enzymes [BR:fca01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     101099494 (GUCY1A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc HNOBA HNOB Rx_N
Motif
Other DBs
NCBI-GeneID: 101099494
NCBI-ProteinID: XP_023094831
Position
D1
AA seq 738 aa AA seqDB search
MSRRKISSESFSSLGSDYLETSPEDEGECPLSRLCWNGSRSPPGPPEPRAAAAVAPAPAA
AASSSSSASAAAAAAAAATAGARRAQRRRRVNLDSLGESISRLTAPSPQTIQQTLQRTLQ
YYEHQVIGYRDAERNFHNISNRCSYADHSNKEGIEDVSGILQCTANILGLKFEELQERFG
EEFFNICFDENERVLRAVGGTLQDFFNGFDALLEHIRTSFGKQATLESPSFLCKELPEGA
LLLHYFRPHHVVGFAMLGMIKAAGKKIYRLDVSVEQVANEKLCSDGSNPGNCSCLTFLIK
ECDNTDAMKNLPRGASRVPADLRISISTFCRAFPFHLMFDAHMSVLQLGEGLRKQLRCDT
HKVLRFEDCFEIVSPKVSAAFERVLLRLSTPFVIRTKPEASGTENKDKVMEVKGQMIHVP
ESNSILFLGSPCVDKLDELMGRGLHLSDIPIHDATRDVILVGEQAKAQDGLKKRMDKLKA
TLERTHQALEEEKKKTVDLLYSIFPGDVAQQLWQGQQVQARKFDDVTMLFSDIVGFTAIC
AQCTPMQVISMLNELYTRFDHQCGFLDIYKVETIGDAYCVAAGLHRKSLCHAKPIALMAL
KMMELSEEVLTPDGRPIQMRIGIHSGSVLAGVVGVRMPRYCLFGNNVTLASKFESGSHPR
RINVSPTTYQLLKREESFTFIPRSREELPDNFPKEIPGICYFLEVRTGPKQPKPSLSSSR
IKKVSYNIGTMFLRETSL
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atgtctcggaggaagatctcgtccgagtccttcagctccctgggctccgactacctggag
accagtcccgaggacgagggcgagtgccccctgtcccggctctgctggaacggcagccgg
agcccgcccgggccgcccgagccccgcgcggccgccgccgtcgccccggcccctgccgcc
gccgcctcctcctcctcctcagcctcagccgccgccgccgccgccgccgccgccacggcc
ggggcccggagggcgcagcgccggaggcgggtcaacctggactcgctgggagagagcatc
agccgcctgacggcgccctcgcctcagacgatacagcagactctccagaggacgctgcag
tattatgagcaccaagttattggttacagggatgcagaaaggaatttccacaatatctct
aacagatgctcctatgcagaccattccaacaaagagggtattgaagacgtctcaggaatc
cttcaatgcactgctaatatactcggtttgaagtttgaggaacttcaagaaagatttggt
gaggagttctttaacatatgctttgatgagaatgagagagtccttcgagctgtaggtggc
actttgcaggacttttttaatggctttgatgctttgttggaacacatcagaacttccttt
gggaaacaggccacgctggagtccccatcgttcctgtgcaaggagctccccgagggtgcc
cttctgcttcactacttccgtcctcaccacgttgtgggctttgcaatgctgggcatgatc
aaggctgcaggaaagaagatctaccggctggacgtgagcgtggagcaggtggccaatgag
aaactgtgctccgatggttcgaacccaggcaactgtagctgtcttaccttcctcatcaaa
gaatgtgacaatactgatgccatgaagaaccttccccggggagcctcccgagtccctgcc
gacctcagaatcagcatcagcaccttctgcagggccttccctttccacttgatgttcgac
gcccacatgtccgtcctgcagctgggggaaggcctgcggaagcagctgcgttgcgacacc
cacaaagtgctcaggtttgaggactgcttcgagatcgtttctccaaaggtcagtgccgcc
tttgagagggtcctgttgcgactgtccaccccgtttgtgatcaggaccaagcctgaggct
tctggcactgaaaataaagacaaggtgatggaagtcaagggacagatgatccatgttcca
gagtcaaattccatcttattcttgggctctccatgtgtggacaagttggatgaactcatg
ggccgagggctgcatctctcagacatccctatccatgatgccacccgagatgtcattctg
gttggtgagcaggccaaggcccaagatggcttgaagaagaggatggataaactaaaggcg
accttggaaagaactcaccaggccctggaagaagagaaaaagaaaacagtggatcttctg
tattcgattttccctggtgatgtagctcagcagctgtggcaaggacagcaggtgcaggcc
agaaagtttgatgatgtcaccatgctcttttcagacattgttggcttcacagccatctgt
gcccagtgtacccccatgcaggtgatcagcatgctgaatgaactgtataccagatttgac
caccagtgtggatttttggatatttacaaggtggaaacaataggtgatgcatactgtgtt
gccgcaggactccataggaaaagcctctgccacgccaagcccattgctctcatggccctg
aagatgatggaactttcagaagaggtgctgacacctgatggaagaccaattcagatgagg
ataggcatccactcaggttctgtgctcgctggagttgttggggtaagaatgccacgatat
tgcctgtttggaaataatgtcactctggcaagcaaattcgaatcaggaagtcaccctcgg
cgcatcaacgtcagccctaccacttaccaattattaaaacgggaagaaagcttcacattc
attcctcggtcccgtgaagagcttccagataactttccaaaggaaatccctgggatctgc
tatttcctggaggtaaggactggtcctaagcagccaaagccttctctttcttcatcaaga
atcaagaaagtttcctacaacattggcaccatgttcctccgggagacaagcctctga

DBGET integrated database retrieval system