KEGG   Felis catus (domestic cat): 101089679Help
Entry
101089679         CDS       T02385                                 

Gene name
GNAI2
Definition
(RefSeq) guanine nucleotide-binding protein G(i) subunit alpha-2
  KO
K04630  guanine nucleotide-binding protein G(i) subunit alpha
Organism
fca  Felis catus (domestic cat)
Pathway
fca04015  Rap1 signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04024  cAMP signaling pathway
fca04062  Chemokine signaling pathway
fca04071  Sphingolipid signaling pathway
fca04261  Adrenergic signaling in cardiomyocytes
fca04360  Axon guidance
fca04371  Apelin signaling pathway
fca04540  Gap junction
fca04611  Platelet activation
fca04670  Leukocyte transendothelial migration
fca04713  Circadian entrainment
fca04723  Retrograde endocannabinoid signaling
fca04724  Glutamatergic synapse
fca04725  Cholinergic synapse
fca04726  Serotonergic synapse
fca04727  GABAergic synapse
fca04728  Dopaminergic synapse
fca04730  Long-term depression
fca04914  Progesterone-mediated oocyte maturation
fca04915  Estrogen signaling pathway
fca04916  Melanogenesis
fca04921  Oxytocin signaling pathway
fca04923  Regulation of lipolysis in adipocytes
fca04924  Renin secretion
fca04926  Relaxin signaling pathway
fca04928  Parathyroid hormone synthesis, secretion and action
fca04934  Cushing syndrome
fca04971  Gastric acid secretion
fca05012  Parkinson disease
fca05030  Cocaine addiction
fca05032  Morphine addiction
fca05034  Alcoholism
fca05133  Pertussis
fca05142  Chagas disease (American trypanosomiasis)
fca05145  Toxoplasmosis
fca05163  Human cytomegalovirus infection
fca05170  Human immunodeficiency virus 1 infection
fca05200  Pathways in cancer
Module
fca_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101089679 (GNAI2)
   04371 Apelin signaling pathway
    101089679 (GNAI2)
   04071 Sphingolipid signaling pathway
    101089679 (GNAI2)
   04024 cAMP signaling pathway
    101089679 (GNAI2)
   04022 cGMP-PKG signaling pathway
    101089679 (GNAI2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101089679 (GNAI2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101089679 (GNAI2)
   04670 Leukocyte transendothelial migration
    101089679 (GNAI2)
   04062 Chemokine signaling pathway
    101089679 (GNAI2)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    101089679 (GNAI2)
   04915 Estrogen signaling pathway
    101089679 (GNAI2)
   04914 Progesterone-mediated oocyte maturation
    101089679 (GNAI2)
   04921 Oxytocin signaling pathway
    101089679 (GNAI2)
   04926 Relaxin signaling pathway
    101089679 (GNAI2)
   04928 Parathyroid hormone synthesis, secretion and action
    101089679 (GNAI2)
   04916 Melanogenesis
    101089679 (GNAI2)
   04924 Renin secretion
    101089679 (GNAI2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101089679 (GNAI2)
  09154 Digestive system
   04971 Gastric acid secretion
    101089679 (GNAI2)
  09156 Nervous system
   04724 Glutamatergic synapse
    101089679 (GNAI2)
   04727 GABAergic synapse
    101089679 (GNAI2)
   04725 Cholinergic synapse
    101089679 (GNAI2)
   04728 Dopaminergic synapse
    101089679 (GNAI2)
   04726 Serotonergic synapse
    101089679 (GNAI2)
   04730 Long-term depression
    101089679 (GNAI2)
   04723 Retrograde endocannabinoid signaling
    101089679 (GNAI2)
  09158 Development
   04360 Axon guidance
    101089679 (GNAI2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101089679 (GNAI2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101089679 (GNAI2)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    101089679 (GNAI2)
  09165 Substance dependence
   05030 Cocaine addiction
    101089679 (GNAI2)
   05032 Morphine addiction
    101089679 (GNAI2)
   05034 Alcoholism
    101089679 (GNAI2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101089679 (GNAI2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    101089679 (GNAI2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101089679 (GNAI2)
   05163 Human cytomegalovirus infection
    101089679 (GNAI2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101089679 (GNAI2)
   05142 Chagas disease (American trypanosomiasis)
    101089679 (GNAI2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101089679 (GNAI2)
   04031 GTP-binding proteins [BR:fca04031]
    101089679 (GNAI2)
Exosome [BR:fca04147]
 Exosomal proteins
  Proteins found in most exosomes
   101089679 (GNAI2)
GTP-binding proteins [BR:fca04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    101089679 (GNAI2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc AAA_16 TniB AAA_29
Motif
Other DBs
NCBI-GeneID: 101089679
NCBI-ProteinID: XP_011289977
Ensembl: ENSFCAG00000007008
Position
A2
AA seq 355 aa AA seqDB search
MGCTVSAEDKAAAERSKMIDKNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEDG
YSEEECRQYRAVVYSNTIQSIMAIVKAMGNLQIDFADPSRADDARQLFALSCTAEEQGVL
PEDLSGVIRRLWADHGVQACFGRSREYQLNDSAAYYLNDLERIAQSDYIPTQQDVLRTRV
KTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEE
MNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKITHSPLTICFPEYTGANKYDEA
ASYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgggctgcaccgtgagtgccgaggacaaggcggcggccgagcgctctaagatgatcgac
aagaatctgcgggaagacggcgagaaggcggcgcgggaggtgaagttgctgcttttgggt
gctggggagtcagggaagagcaccattgtcaagcagatgaagatcatccatgaggatggc
tattccgaggaggagtgccggcagtaccgggcggtcgtctacagcaacaccatccagtcc
atcatggccattgtcaaagccatgggcaatctgcagattgactttgccgacccctcccga
gcggatgatgccaggcagctgtttgcactctcctgtactgctgaggagcaaggcgtgctc
cctgaggatctgtctggtgtcatccggaggctctgggctgaccacggtgtgcaggcttgc
tttggccgctctcgggagtaccagctcaatgactccgctgcctactacctgaatgacctg
gagcgcatcgcgcagagcgactacatccccacacagcaggacgtgctacggacccgtgtg
aaaaccacgggcatcgtggagacacacttcaccttcaaggacctacacttcaagatgttt
gatgtgggcggtcagcggtctgagcggaagaagtggatccactgctttgagggtgtcaca
gccatcatcttctgcgtagccttgagcgcctatgacctggtgctagctgaggacgaggag
atgaaccgcatgcacgagagcatgaagctgtttgacagtatctgcaacaacaagtggttc
acagacacgtccatcatcctcttcctcaacaagaaggacctgtttgaggagaagatcaca
cacagccccctgaccatctgcttccctgagtacacaggggccaacaagtatgacgaggca
gccagctacatccagagtaagtttgaggacctgaacaagcgcaaggacaccaaggagatc
tatacgcacttcacttgtgccaccgacaccaagaacgtgcagtttgtgttcgatgccgtc
accgacgtcatcatcaagaacaacctgaaggactgcggcctcttctga

KEGG   Felis catus (domestic cat): 101092837Help
Entry
101092837         CDS       T02385                                 

Gene name
GNAI1
Definition
(RefSeq) guanine nucleotide-binding protein G(i) subunit alpha-1 isoform X1
  KO
K04630  guanine nucleotide-binding protein G(i) subunit alpha
Organism
fca  Felis catus (domestic cat)
Pathway
fca04015  Rap1 signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04024  cAMP signaling pathway
fca04062  Chemokine signaling pathway
fca04071  Sphingolipid signaling pathway
fca04261  Adrenergic signaling in cardiomyocytes
fca04360  Axon guidance
fca04371  Apelin signaling pathway
fca04540  Gap junction
fca04611  Platelet activation
fca04670  Leukocyte transendothelial migration
fca04713  Circadian entrainment
fca04723  Retrograde endocannabinoid signaling
fca04724  Glutamatergic synapse
fca04725  Cholinergic synapse
fca04726  Serotonergic synapse
fca04727  GABAergic synapse
fca04728  Dopaminergic synapse
fca04730  Long-term depression
fca04914  Progesterone-mediated oocyte maturation
fca04915  Estrogen signaling pathway
fca04916  Melanogenesis
fca04921  Oxytocin signaling pathway
fca04923  Regulation of lipolysis in adipocytes
fca04924  Renin secretion
fca04926  Relaxin signaling pathway
fca04928  Parathyroid hormone synthesis, secretion and action
fca04934  Cushing syndrome
fca04971  Gastric acid secretion
fca05012  Parkinson disease
fca05030  Cocaine addiction
fca05032  Morphine addiction
fca05034  Alcoholism
fca05133  Pertussis
fca05142  Chagas disease (American trypanosomiasis)
fca05145  Toxoplasmosis
fca05163  Human cytomegalovirus infection
fca05170  Human immunodeficiency virus 1 infection
fca05200  Pathways in cancer
Module
fca_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101092837 (GNAI1)
   04371 Apelin signaling pathway
    101092837 (GNAI1)
   04071 Sphingolipid signaling pathway
    101092837 (GNAI1)
   04024 cAMP signaling pathway
    101092837 (GNAI1)
   04022 cGMP-PKG signaling pathway
    101092837 (GNAI1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101092837 (GNAI1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101092837 (GNAI1)
   04670 Leukocyte transendothelial migration
    101092837 (GNAI1)
   04062 Chemokine signaling pathway
    101092837 (GNAI1)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    101092837 (GNAI1)
   04915 Estrogen signaling pathway
    101092837 (GNAI1)
   04914 Progesterone-mediated oocyte maturation
    101092837 (GNAI1)
   04921 Oxytocin signaling pathway
    101092837 (GNAI1)
   04926 Relaxin signaling pathway
    101092837 (GNAI1)
   04928 Parathyroid hormone synthesis, secretion and action
    101092837 (GNAI1)
   04916 Melanogenesis
    101092837 (GNAI1)
   04924 Renin secretion
    101092837 (GNAI1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101092837 (GNAI1)
  09154 Digestive system
   04971 Gastric acid secretion
    101092837 (GNAI1)
  09156 Nervous system
   04724 Glutamatergic synapse
    101092837 (GNAI1)
   04727 GABAergic synapse
    101092837 (GNAI1)
   04725 Cholinergic synapse
    101092837 (GNAI1)
   04728 Dopaminergic synapse
    101092837 (GNAI1)
   04726 Serotonergic synapse
    101092837 (GNAI1)
   04730 Long-term depression
    101092837 (GNAI1)
   04723 Retrograde endocannabinoid signaling
    101092837 (GNAI1)
  09158 Development
   04360 Axon guidance
    101092837 (GNAI1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101092837 (GNAI1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101092837 (GNAI1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    101092837 (GNAI1)
  09165 Substance dependence
   05030 Cocaine addiction
    101092837 (GNAI1)
   05032 Morphine addiction
    101092837 (GNAI1)
   05034 Alcoholism
    101092837 (GNAI1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101092837 (GNAI1)
  09171 Infectious disease: bacterial
   05133 Pertussis
    101092837 (GNAI1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101092837 (GNAI1)
   05163 Human cytomegalovirus infection
    101092837 (GNAI1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101092837 (GNAI1)
   05142 Chagas disease (American trypanosomiasis)
    101092837 (GNAI1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101092837 (GNAI1)
   04031 GTP-binding proteins [BR:fca04031]
    101092837 (GNAI1)
Exosome [BR:fca04147]
 Exosomal proteins
  Proteins found in most exosomes
   101092837 (GNAI1)
GTP-binding proteins [BR:fca04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    101092837 (GNAI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc TniB AAA_16 AAA_29 FtsK_SpoIIIE
Motif
Other DBs
NCBI-GeneID: 101092837
NCBI-ProteinID: XP_011278647
UniProt: M3W792
Position
A2
AA seq 354 aa AA seqDB search
MGCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAG
YSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVLAGAAEEGFMT
AELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVK
TTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEM
NRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAA
AYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgggctgtacgctgagcgccgaggacaaggcggcggtggagcggagtaagatgatcgac
cggaacctccgcgaggatggcgagaaggcggcgcgcgaggtcaagctgctgctgctcggt
gctggtgaatctgggaaaagcacaattgtgaagcaaatgaaaattatccatgaagctggt
tattcggaggaggaatgtaaacagtacaaagcggtggtctacagcaacaccatccaatca
attattgctatcattagggccatggggaggttgaagatagacttcggtgactcagctcgg
gcggatgatgcccgccaactgtttgtgcttgctggagccgctgaagaaggctttatgact
gcagaacttgccggagttataaagagattgtggaaagatagtggtgtacaggcctgtttc
aacagatcccgagagtaccagcttaatgattccgcagcatactatttgaatgacttggac
agaatagcacaaccaaactacattccaactcaacaagatgttctcagaactagagtgaaa
actacaggaattgttgaaacccattttactttcaaagatcttcattttaaaatgtttgat
gtgggaggacagagatctgagcggaagaagtggattcattgcttcgaaggagtgaccgcc
atcatcttctgtgtggctctgagtgactatgacctggttctagccgaagatgaggaaatg
aatcgaatgcatgaaagcatgaagttgtttgacagcatatgtaacaacaaatggtttaca
gatacgtctattatactttttctaaacaagaaggatctctttgaagaaaaaatcaaaaag
agccctctcactatatgctatccagaatacgcaggctcaaacacatatgaagaggcagct
gcgtatattcagtgtcagtttgaagacctcaataaaagaaaggacacaaaggaaatatac
acccacttcacatgtgccacagatacgaagaatgtgcagtttgtttttgatgctgtaaca
gatgtcatcataaaaaataatctaaaagattgtggtctcttctaa

KEGG   Felis catus (domestic cat): 101100320Help
Entry
101100320         CDS       T02385                                 

Gene name
GNAI3
Definition
(RefSeq) guanine nucleotide-binding protein G(k) subunit alpha
  KO
K04630  guanine nucleotide-binding protein G(i) subunit alpha
Organism
fca  Felis catus (domestic cat)
Pathway
fca04015  Rap1 signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04024  cAMP signaling pathway
fca04062  Chemokine signaling pathway
fca04071  Sphingolipid signaling pathway
fca04261  Adrenergic signaling in cardiomyocytes
fca04360  Axon guidance
fca04371  Apelin signaling pathway
fca04540  Gap junction
fca04611  Platelet activation
fca04670  Leukocyte transendothelial migration
fca04713  Circadian entrainment
fca04723  Retrograde endocannabinoid signaling
fca04724  Glutamatergic synapse
fca04725  Cholinergic synapse
fca04726  Serotonergic synapse
fca04727  GABAergic synapse
fca04728  Dopaminergic synapse
fca04730  Long-term depression
fca04914  Progesterone-mediated oocyte maturation
fca04915  Estrogen signaling pathway
fca04916  Melanogenesis
fca04921  Oxytocin signaling pathway
fca04923  Regulation of lipolysis in adipocytes
fca04924  Renin secretion
fca04926  Relaxin signaling pathway
fca04928  Parathyroid hormone synthesis, secretion and action
fca04934  Cushing syndrome
fca04971  Gastric acid secretion
fca05012  Parkinson disease
fca05030  Cocaine addiction
fca05032  Morphine addiction
fca05034  Alcoholism
fca05133  Pertussis
fca05142  Chagas disease (American trypanosomiasis)
fca05145  Toxoplasmosis
fca05163  Human cytomegalovirus infection
fca05170  Human immunodeficiency virus 1 infection
fca05200  Pathways in cancer
Module
fca_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101100320 (GNAI3)
   04371 Apelin signaling pathway
    101100320 (GNAI3)
   04071 Sphingolipid signaling pathway
    101100320 (GNAI3)
   04024 cAMP signaling pathway
    101100320 (GNAI3)
   04022 cGMP-PKG signaling pathway
    101100320 (GNAI3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101100320 (GNAI3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101100320 (GNAI3)
   04670 Leukocyte transendothelial migration
    101100320 (GNAI3)
   04062 Chemokine signaling pathway
    101100320 (GNAI3)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    101100320 (GNAI3)
   04915 Estrogen signaling pathway
    101100320 (GNAI3)
   04914 Progesterone-mediated oocyte maturation
    101100320 (GNAI3)
   04921 Oxytocin signaling pathway
    101100320 (GNAI3)
   04926 Relaxin signaling pathway
    101100320 (GNAI3)
   04928 Parathyroid hormone synthesis, secretion and action
    101100320 (GNAI3)
   04916 Melanogenesis
    101100320 (GNAI3)
   04924 Renin secretion
    101100320 (GNAI3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101100320 (GNAI3)
  09154 Digestive system
   04971 Gastric acid secretion
    101100320 (GNAI3)
  09156 Nervous system
   04724 Glutamatergic synapse
    101100320 (GNAI3)
   04727 GABAergic synapse
    101100320 (GNAI3)
   04725 Cholinergic synapse
    101100320 (GNAI3)
   04728 Dopaminergic synapse
    101100320 (GNAI3)
   04726 Serotonergic synapse
    101100320 (GNAI3)
   04730 Long-term depression
    101100320 (GNAI3)
   04723 Retrograde endocannabinoid signaling
    101100320 (GNAI3)
  09158 Development
   04360 Axon guidance
    101100320 (GNAI3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101100320 (GNAI3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101100320 (GNAI3)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    101100320 (GNAI3)
  09165 Substance dependence
   05030 Cocaine addiction
    101100320 (GNAI3)
   05032 Morphine addiction
    101100320 (GNAI3)
   05034 Alcoholism
    101100320 (GNAI3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101100320 (GNAI3)
  09171 Infectious disease: bacterial
   05133 Pertussis
    101100320 (GNAI3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101100320 (GNAI3)
   05163 Human cytomegalovirus infection
    101100320 (GNAI3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101100320 (GNAI3)
   05142 Chagas disease (American trypanosomiasis)
    101100320 (GNAI3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101100320 (GNAI3)
   04031 GTP-binding proteins [BR:fca04031]
    101100320 (GNAI3)
Exosome [BR:fca04147]
 Exosomal proteins
  Proteins found in most exosomes
   101100320 (GNAI3)
GTP-binding proteins [BR:fca04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    101100320 (GNAI3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc TniB AAA_29 FtsK_SpoIIIE AAA_16
Motif
Other DBs
NCBI-GeneID: 101100320
NCBI-ProteinID: XP_003990458
Ensembl: ENSFCAG00000028811
UniProt: A0A2I2U673
Position
C1
AA seq 354 aa AA seqDB search
MGCTLSAEDKAAVERSKMIDRNLREDGEKAAKEVKLLLLGAGESGKSTIVKQMKIIHEDG
YSEEECKQYKVVVYSNTIQSIIAIIRAMGRLKIDFGEAARADDARQLFVLAGSAEEGVMT
PELAGVIKRLWRDGGVQACFSRSREYQLNDSASYYLNDLDRISQTNYIPTQQDVLRTRVK
TTGIVETHFTFKDLYFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEM
NRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKRSPLTICYPEYTGSNTYEEAA
AYIQCQFEDLNRRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKECGLY
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgggctgcacgttgagcgccgaggacaaggcggcggtggagcggagcaagatgatcgac
cgcaacttgcgggaggacggggagaaagcggccaaagaagtgaagctgctgctactcggt
gctggagaatctggtaaaagcaccatcgtgaaacagatgaaaatcattcatgaggatggc
tattcggaggaagaatgtaaacaatataaagtagttgtctacagcaataccatacagtcc
atcattgcaatcataagagccatgggacggctaaagattgactttggggaagctgccaga
gcagatgatgcccggcaattatttgttttggctggcagtgctgaagaaggagtcatgact
ccagaactagcaggagtgattaaacggttatggcgagatggtggggtgcaagcttgcttc
agcagatccagggagtatcagcttaatgattctgcttcatattacctaaatgatttggat
agaatatcccaaaccaactacattccaactcagcaagatgtcctgcggacaagagtgaag
accacaggcatcgtggaaacgcacttcaccttcaaagacctatacttcaagatgtttgat
gtaggtggccagagatcagaacgcaaaaagtggattcactgttttgagggagtgacagca
attatcttctgtgtggccctcagtgattatgaccttgttctggctgaggatgaggagatg
aaccgaatgcatgaaagcatgaaactgtttgacagcatttgtaacaacaaatggtttaca
gacacttcaatcattctcttcctcaacaagaaagatctttttgaggaaaaaataaagagg
agtccattaactatctgttatccagaatacacgggttccaatacatatgaagaagcagct
gcttatattcagtgccagtttgaagatctgaacagaagaaaagacaccaaggagatctat
actcacttcacctgtgccacagacaccaagaatgtgcagtttgtttttgatgctgttaca
gatgtcatcattaaaaacaacttaaaggaatgtggactttactga

DBGET integrated database retrieval system